Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.97
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.100 5.3e-05
tuberculosis and treatment for 6 months -1.200 3.8e-05
lung cancer 1.800 5.2e-05
colon cancer 1.100 3.9e-03
subependymal giant cell astrocytoma 1.226 1.7e-02
acute myeloid leukemia -1.800 3.5e-02
Breast cancer 1.100 1.6e-05

Gene RIF (3)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 6 (GEMIN6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
11748230 Gemin6 is a component of the SMN complex that localizes to gems and interacts with several Sm proteins of the spliceosomal snRNPs.

AA Sequence

MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET      1 - 70
MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYG     71 - 140
PENCSSSNEIILSRVQDLIEGHLTASQ                                               141 - 167
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15939020 2005 The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure.
15848170 2005 Unrip is a component of SMN complexes active in snRNP assembly.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.