Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.17
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.800 3.5e-02
Breast cancer 1.100 1.6e-05
colon cancer 1.100 3.9e-03
glioblastoma 1.100 5.3e-05
lung cancer 1.600 1.5e-04
subependymal giant cell astrocytoma 1.226 1.7e-02
tuberculosis and treatment for 6 months -1.200 3.8e-05

Gene RIF (3)

AA Sequence

MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET      1 - 70
MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYG     71 - 140
PENCSSSNEIILSRVQDLIEGHLTASQ                                               141 - 167
//

Text Mined References (21)

PMID Year Title