Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.57
PubTator Score 24.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 2.8e-05
cutaneous lupus erythematosus -1.300 3.2e-02
psoriasis 1.500 2.1e-04
osteosarcoma -2.579 4.1e-07
atypical teratoid / rhabdoid tumor 1.500 7.2e-07
medulloblastoma, large-cell 1.300 1.9e-05
colon cancer 1.300 1.1e-02
group 3 medulloblastoma 1.700 1.4e-05
ovarian cancer 1.300 1.1e-05

Gene RIF (15)

PMID Text
25555524 These findings indicate that GEMIN4 functions as a novel coregulator of the MR.
22506892 the association between the GEMIN4 gene and the risk of prostate cancer
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 4 (GEMIN4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19047128 Observational study of gene-disease association. (HuGE Navigator)
18675250 A canonical nuclear import sequence in the N-terminus of Gemin4 was identified.
16301532 Gemin3 and Gemin4 function in Sm core assembly and correlate the activity of this pathway with Spinal Muscular Atrophy.
14603441 A haplotype of HCAP1 with minor alleles at 5 single nucleotide polymorphisms may be related to cancer susceptibility: its expression causes up-regulation of genes involved in cell growth and down-regulation of genes involved in apoptosis and DNA repair.
12869526 zinc-finger proteins were identified as HCAP1-interacting proteins

AA Sequence

MDLGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHSQPFAWKKKAL      1 - 70
IIIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAE     71 - 140
LERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAMAHKYLPALDEFPHPPKRLRSDPDAC    141 - 210
PTMPLLAMLLRGLTQIQSRILGPGRKCCALANLADMLTVFALTEDDPQEVSATVYLDKLATVISVWNSDT    211 - 280
QNPYHQQALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLRSSQGTSYDSYRLCD    281 - 350
SLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHME    351 - 420
VCYIFASEKKWAFSDEWVACLGSNRALFRQPDLVLRLLETVIDVSTADRAIPESQIRQVIHLILECYADL    421 - 490
SLPGKNKVLAGILRSWGRKGLSEKLLAYVEGFQEDLNTTFNQLTQSASEQGLAKAVASVARLVIVHPEVT    491 - 560
VKKMCSLAVVNLGTHKFLAQILTAFPALRFVEEQGPNSSATFMVSCLKETVWMKFSTPKEEKQFLELLNC    561 - 630
LMSPVKPQGIPVAALLEPDEVLKEFVLPFLRLDVEEVDLSLRIFIQTLEANACREEYWLQTCSPFPLLFS    631 - 700
LCQLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTV    701 - 770
GLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDV    771 - 840
GNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQ    841 - 910
LSVLFLRTFQFLCSHSCRDWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYT    911 - 980
QVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQT    981 - 1050
LLQKMSSF                                                                 1051 - 1058
//

Text Mined References (39)

PMID Year Title
25555524 2015 GEMIN4 functions as a coregulator of the mineralocorticoid receptor.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22506892 2012 Genetic variants in the microRNA machinery gene GEMIN4 are associated with risk of prostate cancer: a case-control study of the Chinese Han population.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20211803 2010 Black carbon exposures, blood pressure, and interactions with single nucleotide polymorphisms in MicroRNA processing genes.
19946888 2010 Defining the membrane proteome of NK cells.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18675250 2008 Identification and characterisation of a nuclear localisation signal in the SMN associated protein, Gemin4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16301532 2005 Gemin proteins are required for efficient assembly of Sm-class ribonucleoproteins.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14603441 2004 Two variants of the human hepatocellular carcinoma-associated HCAP1 gene and their effect on the growth of the human liver cancer cell line Hep3B.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12668731 2003 Protein phosphatase 4 interacts with the Survival of Motor Neurons complex and enhances the temporal localisation of snRNPs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11714716 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.
11713266 2001 The methylosome, a 20S complex containing JBP1 and pICln, produces dimethylarginine-modified Sm proteins.
11642406 2001 Cloning and characterization of a novel gene (C17orf25) from the deletion region on chromosome 17p13.3 in hepatocelular carcinoma.
11522829 2001 Association of galectin-1 and galectin-3 with Gemin4 in complexes containing the SMN protein.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11149922 2001 A functional interaction between the survival motor neuron complex and RNA polymerase II.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.