Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.68
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -2.300 7.0e-08
glioblastoma 2.400 5.0e-03
posterior fossa group A ependymoma 3.200 1.2e-13
atypical teratoid / rhabdoid tumor 1.900 2.3e-02
adrenocortical carcinoma -2.132 2.0e-04
tuberculosis -4.900 3.7e-10
primary pancreatic ductal adenocarcinoma 4.027 3.0e-06
intraductal papillary-mucinous adenoma (... -1.500 3.9e-02
intraductal papillary-mucinous neoplasm ... -2.100 2.0e-02
colon cancer -2.900 3.0e-03
lung cancer -1.900 1.4e-05
interstitial cystitis 1.800 1.2e-03
pediatric high grade glioma 1.300 1.6e-02
subependymal giant cell astrocytoma 2.769 2.2e-02
Breast cancer -1.800 5.0e-08
lung carcinoma -1.100 1.5e-04
breast carcinoma -1.100 1.6e-10
spina bifida -1.695 3.6e-02
gastric carcinoma 2.700 5.1e-03
ulcerative colitis 2.700 7.5e-06
ovarian cancer 1.700 7.9e-03
pituitary cancer -2.700 3.7e-05
pancreatic cancer 3.900 5.2e-05

Gene RIF (9)

PMID Text
25173885 These findings demonstrate a new role of Gem/Gmip/RhoA signaling in cortical actin regulation during early mitotic stages.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of GTP binding protein overexpressed in skeletal muscle (GEM) in primary human brain microvascular endothelial cells
24586148 Gem is involved both in T-cell spontaneous cell migration as well as chemotaxis and plays an important role in cell-to-cell HTLV-1 viral transmission.
22964304 Data show a mechanism by which GTPase Gem contributes to the mitotic progression by maintaining correct spindle length through the kinesin Kif9.
22589533 Gem contains two candidate inhibitory sites, each capable of producing full inhibition of P/Q-type Ca(2+) channels.
20233927 GEM plays a key role during C. pneumoniae entry into human cells.
17107948 Gem is a bona fide GTPase that exhibits striking structural and biochemical features that should impact its regulation and cellular activities
17052716 crystallographic structure and biochemical characterization indicate that Gem G-domain markedly prefers GDP over GTP
16242932 We discuss the structural and functional properties of RGK proteins and highlight recent work addressing the mechanism of Gem regulation by calmodulin and 14-3-3.

AA Sequence

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE      1 - 70
SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE     71 - 140
WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA    141 - 210
VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN    211 - 280
MAFKLKSKSCHDLSVL                                                          281 - 296
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25173885 2014 Gem GTPase acts upstream Gmip/RhoA to regulate cortical actin remodeling and spindle positioning during early mitosis.
24586148 2014 Gem-induced cytoskeleton remodeling increases cellular migration of HTLV-1-infected cells, formation of infected-to-target T-cell conjugates and viral transmission.
22964304 2012 The GTPase Gem and its partner Kif9 are required for chromosome alignment, spindle length control, and mitotic progression.
22589533 2012 Molecular determinants of Gem protein inhibition of P/Q-type Ca2+ channels.
20233927 2010 A systemic network for Chlamydia pneumoniae entry into human cells.
19060904 2009 An empirical framework for binary interactome mapping.
17107948 2007 Biochemical and structural characterization of the gem GTPase.
17052716 2006 Structure-function studies of the G-domain from human gem, a novel small G-protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16242932 2005 The RGK family: a regulatory tail of small GTP-binding proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701738 2004 Phosphorylation of critical serine residues in Gem separates cytoskeletal reorganization from down-regulation of calcium channel activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093360 2002 A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.
11956230 2002 The GTP binding proteins Gem and Rad are negative regulators of the Rho-Rho kinase pathway.
11395774 2001 Regulation of Ca2+ channel expression at the cell surface by the small G-protein kir/Gem.
9115241 1997 Rad and Rad-related GTPases interact with calmodulin and calmodulin-dependent protein kinase II.
8825643 1995 Chromosomal organization and transcriptional regulation of human GEM and localization of the human and mouse GEM loci encoding an inducible Ras-like protein.
7912851 1994 Gem: an induced, immediate early protein belonging to the Ras family.
7809057 1994 Transcriptional activation of a ras-like gene (kir) by oncogenic tyrosine kinases.