Property Summary

NCBI Gene PubMed Count 13
PubMed Score 17.64
PubTator Score 12.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 1.2e-04
atypical teratoid / rhabdoid tumor -1.400 1.0e-05
breast carcinoma -1.300 1.2e-03
ductal carcinoma in situ -1.400 8.3e-04
ependymoma -1.200 1.0e-07
fibroadenoma -1.600 2.3e-02
glioblastoma -1.100 4.7e-06
osteosarcoma -1.834 4.5e-04
psoriasis -1.300 4.2e-04
sonic hedgehog group medulloblastoma -1.200 1.5e-03

Gene RIF (3)

AA Sequence

MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLYFWWEVHNDYD      1 - 70
EFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMS     71 - 140
AVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFFTVVFALYLAP    141 - 210
LTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLR    211 - 280
RTTNVEEEFPELARRPASMLNWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAK    281 - 350
GNATLLLNLRDPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS    351 - 420
LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHALSQVPSPLWI    421 - 490
MPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISD    491 - 560
GVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR                             561 - 605
//

Text Mined References (13)

PMID Year Title