Property Summary

NCBI Gene PubMed Count 25
PubMed Score 26.04
PubTator Score 19.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.704 9.0e-05
Multiple myeloma 1.355 1.7e-04
malignant mesothelioma -1.100 4.2e-06
osteosarcoma -1.058 1.4e-03
sonic hedgehog group medulloblastoma 1.600 1.2e-04
medulloblastoma, large-cell 1.600 3.8e-05
acute quadriplegic myopathy 1.250 2.0e-06
pancreatic ductal adenocarcinoma liver m... -2.140 4.5e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.5e-02
glioblastoma multiforme -1.300 1.5e-02
breast carcinoma 1.100 3.5e-02
diabetes mellitus 1.800 1.1e-03
lung adenocarcinoma 1.314 3.3e-08
ovarian cancer -1.100 4.6e-04

Gene RIF (3)

PMID Text
17507299 The increased levels of cyclin I and GDI2 found to be associated with pancreatic carcinoma were further confirmed by Western blot analyses in an independent series of serum samples and/or pancreatic juice samples
16385451 Observational study of gene-disease association. (HuGE Navigator)
11771757 Reduction of nucleoside diphosphate kinase B, Rab GDP-dissociation inhibitor beta and histidine triad nucleotide-binding protein in fetal Down syndrome brain.

AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF     71 - 140
RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL    211 - 280
ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI    281 - 350
AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI    351 - 420
YKRMTGSEFDFEEMKRKKNDIYGED                                                 421 - 445
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727862 2013 Genome-wide association study identifies two susceptibility loci for osteosarcoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19570034 2009 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17507299 2007 Serum proteomic-based analysis of pancreatic carcinoma for the identification of potential cancer biomarkers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809807 2002 The hematopoiesis-specific GTP-binding protein RhoH is GTPase deficient and modulates activities of other Rho GTPases by an inhibitory function.
11771757 2001 Reduction of nucleoside diphosphate kinase B, Rab GDP-dissociation inhibitor beta and histidine triad nucleotide-binding protein in fetal Down syndrome brain.
10996854 2000 Impairment of bile salt-dependent lipase secretion in human pancreatic tumoral SOJ-6 cells.
10512627 1999 General role of GDP dissociation inhibitor 2 in membrane release of Rab proteins: modulations of its functional interactions by in vitro and in vivo structural modifications.
9434952 1998 The human rab GDI beta gene with long retroposon-rich introns maps to 10p15 and its pseudogene to 7p11-p13.
8575461 1995 Pericentriolar targeting of GDP-dissociation inhibitor isoform 2.
7929030 1994 Differential intracellular localizations of GDP dissociation inhibitor isoforms. Insulin-dependent redistribution of GDP dissociation inhibitor-2 in 3T3-L1 adipocytes.
7585614 1995 Cloning of a brain-type isoform of human Rab GDI and its expression in human neuroblastoma cell lines and tumor specimens.
7543319 1995 Expression patterns of two human genes coding for different rab GDP-dissociation inhibitors (GDIs), extremely conserved proteins involved in cellular transport.
7513052 1994 Cloning, characterization, and expression of a novel GDP dissociation inhibitor isoform from skeletal muscle.