Property Summary

NCBI Gene PubMed Count 57
PubMed Score 34.48
PubTator Score 120.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.300 3.1e-03
lung carcinoma 1.200 6.1e-34
ovarian cancer 1.400 7.9e-06

Gene RIF (13)

PMID Text
25694352 Human oligodendrogliomas cells stably expressing mutant GDI1 showed altered cell proliferation.
25346144 Data confirm isolated adrenocorticotropin deficiency (IAD) as autoimmune disease; RABGDIA (human, human recombinant, or rat) exhibits characteristics of autoantigen in anterior pituitary; patients with IAD exhibit autoantibodies against RABGDIA.
23140504 The results of this study identified RabGDI as a component of the switching mechanism that is required for commissural axons to change their response from attraction to repulsion at the intermediate target
22002931 GDI1 mutations cause an unspecific phenotype characterized by cognitive deficits of variable degree in males, and to a lesser degree in female carriers.
21736009 The mutations in this gene are common and do not seem to influence the gene expression so as to cause a change in phenotype.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19996123 A model by which mutant PrP induces overexpression of GDI, activating a cytotoxic feedback loop that leads to protein accumulation in the secretory pathway.
19570034 GDI-1 is preferentially involved in insulin-stimulated glucose transporter 4 (GLUT4) translocation through facilitating Rab10 recycling.
18487148 The results of case-control analysis indicated that, no association between the rs11549300 polymorphisms of GDI1 and children NSMR (P >0.05), but its polymorphisms may be related to intelligence levels of children in Qinba region (P =0.03).
18487148 Observational study of gene-disease association. (HuGE Navigator)
16596196 RhoGDI overexpression is associated with paclitaxel resistance in ovarian cancers
15647276 isoprenylcysteine carboxylmethyltransferase regulates Rac1 activity by controlling the interaction of Rac1 with RhoGDI through TNFA
15292224 RhoGDI has a role in inactivating Rho GTPases with ExoS RhoGAP

AA Sequence

MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRF     71 - 140
RKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQL    211 - 280
ICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYI    281 - 350
AIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI    351 - 420
YKRMAGTAFDFENMKRKQNDVFGEAEQ                                               421 - 447
//

Text Mined References (60)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25694352 2015 Tumor-specific mutations in low-frequency genes affect their functional properties.
25416956 2014 A proteome-scale map of the human interactome network.
25346144 2015 Identification of the novel autoantigen candidate Rab GDP dissociation inhibitor alpha in isolated adrenocorticotropin deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23815289 2013 Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.
23140504 2012 RabGDI controls axonal midline crossing by regulating Robo1 surface expression.
22002931 2011 Novel GDI1 mutation in a large family with nonsyndromic X-linked intellectual disability.
21736009 Mutations in GDI1 and X-linked non-specific mental retardation.
21269460 2011 Initial characterization of the human central proteome.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
19996123 2010 Mutant prion protein expression is associated with an alteration of the Rab GDP dissociation inhibitor alpha (GDI)/Rab11 pathway.
19942850 2010 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA.
19570034 2009 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation.
18487148 2008 [Relationship between the polymorphisms of GDI1, children NSMR and their intelligence in Qinba region].
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16596196 2006 Gene expression profiles with cDNA microarray reveal RhoGDI as a predictive marker for paclitaxel resistance in ovarian cancers.
16381901 2006 The LIFEdb database in 2006.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15647276 2005 Tumor necrosis factor alpha stimulation of Rac1 activity. Role of isoprenylcysteine carboxylmethyltransferase.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480879 2004 Alternative splicing in the N-terminus of Alzheimer's presenilin 1.
15292224 2004 ExoS Rho GTPase-activating protein activity stimulates reorganization of the actin cytoskeleton through Rho GTPase guanine nucleotide disassociation inhibitor.
15166316 2004 Dissection of the mammalian midbody proteome reveals conserved cytokinesis mechanisms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12802062 2003 Membrane targeting of Rab GTPases is influenced by the prenylation motif.
12777533 2003 Gene diversity patterns at 10 X-chromosomal loci in humans and chimpanzees.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198156 2002 Defects in cytokinesis, actin reorganization and the contractile vacuole in cells deficient in RhoGDI.
11809807 2002 The hematopoiesis-specific GTP-binding protein RhoH is GTPase deficient and modulates activities of other Rho GTPases by an inhibitory function.
11583574 2001 RhoGDI-binding-defective mutant of Cdc42Hs targets to membranes and activates filopodia formation but does not cycle with the cytosol of mammalian cells.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10751420 2000 PRA1 inhibits the extraction of membrane-bound rab GTPase by GDI1.
9674910 1998 Evaluation of two X chromosomal candidate genes for Rett syndrome: glutamate dehydrogenase-2 (GLUD2) and rab GDP-dissociation inhibitor (GDI1).
9668174 1998 Non-specific X-linked semidominant mental retardation by mutations in a Rab GDP-dissociation inhibitor.
9620768 1998 Mutations in GDI1 are responsible for X-linked non-specific mental retardation.
9490022 1998 Differential properties of D4/LyGDI versus RhoGDI: phosphorylation and rho GTPase selectivity.
9106537 1997 A gene for dominant nonspecific X-linked mental retardation is located in Xq28.
8836150 1996 Prenylation of a Rab1B mutant with altered GTPase activity is impaired in cell-free systems but not in intact mammalian cells.
8826463 1996 A gene for nonspecific X-linked mental retardation (MRX41) is located in the distal segment of Xq28.
8733135 1996 Long-range sequence analysis in Xq28: thirteen known and six candidate genes in 219.4 kb of high GC DNA between the RCP/GCP and G6PD loci.
8491184 1993 A novel role for RhoGDI as an inhibitor of GAP proteins.
8281148 1993 Construction of a transcription map of a 300 kb region around the human G6PD locus by direct cDNA selection.
8248200 1993 Transcriptional organization of a 450-kb region of the human X chromosome in Xq28.
8175798 1994 Determination of structural requirements for the interaction of Rab6 with RabGDI and Rab geranylgeranyltransferase.
7849400 1994 Evolutionary conservation and genomic organization of XAP-4, an Xq28 located gene coding for a human rab GDP-dissociation inhibitor (GDI).
7744738 1995 Quantitative analysis of the interactions between prenyl Rab9, GDP dissociation inhibitor-alpha, and guanine nucleotides.
7585614 1995 Cloning of a brain-type isoform of human Rab GDI and its expression in human neuroblastoma cell lines and tumor specimens.
7543319 1995 Expression patterns of two human genes coding for different rab GDP-dissociation inhibitors (GDIs), extremely conserved proteins involved in cellular transport.
7513052 1994 Cloning, characterization, and expression of a novel GDP dissociation inhibitor isoform from skeletal muscle.
2115118 1990 Molecular cloning and characterization of a novel type of regulatory protein (GDI) for smg p25A, a ras p21-like GTP-binding protein.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.