| Tbio | Growth/differentiation factor 7 |
May play an active role in the motor area of the primate neocortex.
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in the differentiation of tendon cells and spinal cord interneurons. A mutation in this gene may be associated with increased risk for Barrett's esophagus and esophageal adenocarcinoma. [provided by RefSeq, Sep 2016]
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in the differentiation of tendon cells and spinal cord interneurons. A mutation in this gene may be associated with increased risk for Barrett's esophagus and esophageal adenocarcinoma. [provided by RefSeq, Sep 2016]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 7.4e-41 |
| osteosarcoma | 7933 | 1.3e-05 |
| group 4 medulloblastoma | 1875 | 7.8e-03 |
| chronic lymphocytic leukemia | 244 | 1.1e-02 |
| Disease | log2 FC | p |
|---|---|---|
| chronic lymphocytic leukemia | 1.587 | 1.1e-02 |
| psoriasis | -1.200 | 7.4e-41 |
| osteosarcoma | -2.028 | 1.3e-05 |
| group 4 medulloblastoma | 1.100 | 7.8e-03 |
| PMID | Text | |
|---|---|---|
| 25447851 | closest protein-coding genes were respectively GDF7 (rs3072), which encodes a ligand in the bone morphogenetic protein pathway, and TBX5 (rs2701108), which encodes a transcription factor that regulates esophageal and cardiac development | |
| 24155967 | BMP12 induces tenogenic differentiation of adipose-derived stromal cells via the Smad1/5/8 pathway. | |
| 21702718 | studies show that even though tenogenic (BMP 12 and BMP 13) and osteogenic (BMP2) BMPs bind the same receptors with high affinity they signal much differently and result in differential activation of osteogenic and tenogenic markers | |
| 20734064 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20677014 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20334610 | induces ligamentogenic differentiation in mesenchymal progenitors | |
| 20237496 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20102312 | stimulates expression of both chondrogenic and osteoblstic markers in pluripotent mesenchymal C3H10T1/2 cells. | |
| 12741987 | In mouse, the expression of Gdf7 in roof plate cells is required for the fidelity of commissural axon growth. |
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRA 1 - 70 RAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQS 71 - 140 FLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEA 141 - 210 FDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESL 211 - 280 FREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCS 281 - 350 RKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL 351 - 420 SPISILYIDAANNVVYKQYEDMVVEACGCR 421 - 450 //
| PMID | Year | Title | |
|---|---|---|---|
| 26783083 | 2016 | The Barrett-associated variants at GDF7 and TBX5 also increase esophageal adenocarcinoma risk. | |
| 26445383 | 2016 | Effect of adipose-derived stromal cells and BMP12 on intrasynovial tendon repair: A biomechanical, biochemical, and proteomics study. | |
| 26033972 | 2015 | Local rhBMP-12 on an Absorbable Collagen Sponge as an Adjuvant Therapy for Rotator Cuff Repair - A Phase 1, Randomized, Standard of Care Control, Multicenter Study: Safety and Feasibility. | |
| 25447851 | 2015 | Polymorphisms near TBX5 and GDF7 are associated with increased risk for Barrett's esophagus. | |
| 24155967 | 2013 | BMP12 induces tenogenic differentiation of adipose-derived stromal cells. | |
| 21702718 | 2011 | Divergent activities of osteogenic BMP2, and tenogenic BMP12 and BMP13 independent of receptor binding affinities. | |
| 20734064 | 2010 | A large-scale candidate gene association study of age at menarche and age at natural menopause. | |
| 20677014 | 2010 | An approach based on a genome-wide association study reveals candidate loci for narcolepsy. | |
| 20339536 | 2010 | Genome-wide association of lipid-lowering response to statins in combined study populations. | |
| 20334610 | 2010 | BMP12 and BMP13 gene transfer induce ligamentogenic differentiation in mesenchymal progenitor and anterior cruciate ligament cells. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. | |
| 20102312 | 2010 | Effects of cartilage-derived morphogenetic protein-3 on the expression of chondrogenic and osteoblastic markers in the pluripotent mesenchymal C3H10T1/2 cell line. | |
| 16049014 | 2005 | Identification of receptors and signaling pathways for orphan bone morphogenetic protein/growth differentiation factor ligands based on genomic analyses. | |
| 15815621 | 2005 | Generation and annotation of the DNA sequences of human chromosomes 2 and 4. | |
| 12741987 | 2003 | A role for BMP heterodimers in roof plate-mediated repulsion of commissural axons. | |
| 10022976 | 1999 | Isolation of zebrafish gdf7 and comparative genetic mapping of genes belonging to the growth/differentiation factor 5, 6, 7 subgroup of the TGF-beta superfamily. | |
| 9808626 | 1998 | Neuronal patterning by BMPs: a requirement for GDF7 in the generation of a discrete class of commissural interneurons in the mouse spinal cord. |
