Property Summary

NCBI Gene PubMed Count 17
PubMed Score 39.96
PubTator Score 18.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-05
psoriasis 6694 1.5e-03
group 4 medulloblastoma 1855 7.8e-03
Chronic Lymphocytic Leukemia 262 1.1e-02
Disease Target Count Z-score Confidence
Ankylosis 28 3.789 1.9
Barrett's esophagus 182 3.775 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.587 1.1e-02
group 4 medulloblastoma 1.100 7.8e-03
osteosarcoma -2.028 1.3e-05
psoriasis -1.100 1.5e-03

 GO Component (1)

Gene RIF (11)

AA Sequence

MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRA      1 - 70
RAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQS     71 - 140
FLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEA    141 - 210
FDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESL    211 - 280
FREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCS    281 - 350
RKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL    351 - 420
SPISILYIDAANNVVYKQYEDMVVEACGCR                                            421 - 450
//

Text Mined References (18)

PMID Year Title