Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MIQSSQPMSLKLTCSAFRLQRALRFLLGRLPWRVASGARRFRRWLNRYSYTVLSSWPERALISLKNRSRF      1 - 70
LVRPNTRNRAFSWTCRAARSKPRPRRSTALPRSQASSSRHSWAEFLKFRKSFQMSNTSQPDPSRPGTERT     71 - 140
SSKEAGCRPLGQLDSFSWAARPPPGAAGLAVSEGFFRKIRSSAPSSPSFSRALMSNTYLCFLTTGPRSSR    141 - 210
ENTQKSFPATSPREPVTSRLRGKAPALSPSRELSFTSAPF                                  211 - 250
//

Text Mined References (3)

PMID Year Title