Property Summary

NCBI Gene PubMed Count 56
PubMed Score 139.52
PubTator Score 67.17

Knowledge Summary

Patent

No data available

Gene RIF (49)

PMID Text
26678910 In ovarian and breast epithelial cells, epigenetic regulation of GDF2 suppresses anoikis.
26677222 Data suggest ALK1 and ACVR2A/ACVR2B, acting as BMP9 co-receptors, rearrange pro-domains of BMP9--pro-domain dimer complex leading to displacement of pro-domains after receptor binding, release of mature non-dimer BPM9, and activation of signaling.
26645636 IGF1 can enhance BMP9-induced osteogenic differentiation in mesenchymal stem cells.
26609524 BMP9 also influenced the expression of PPARgamma.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
25909848 BMP9 Crosstalk with the Hippo Pathway Regulates Endothelial Cell Matricellular and Chemokine Responses
25751889 structural analysis of the bone morphogenetic protein 9 procomplex
25393508 This review summarizes the indirect connection between BMP9 and liver fibrosis, with a focus on the BMP9 signaling pathway members ALK1, endoglin, Id1, hepcidin and Snail. [review]
25297851 BMP-9 induces vascular smooth muscle cell osteogenic differentiation and calcification via ALK1, Smad and ALP dependent mechanisms.
25237187 BMP9 is regulated by redox-dependent proteolysis
25209393 Data show that bone morphogenetic protein 9 (BMP9) can inhibit the migration and invasion of MDA-MB-231 breast cancer cells and promote osteogenesis and proliferation of HS-5 bone marrow-derived mesenchymal stem cells in the co-culture system.
24805814 These findings suggest that BMP9 can inhibit the proliferation and metastasis of SK-BR-3 cells via inactivating ERK1/2 and PI3K/AKT signaling pathways
24670474 in primary, non-malignant cells BMP-9 stabilizes the epithelial phenotype and inhibits proliferation, in hepatocellular carcinoma cells it induces cell growth and the acquisition of a migratory phenotype.
24413988 these observations indicate that BMP9 is an important mediator of breast cancer bone metastasis and a potential therapeutic target for treating this deadly disease.
24337584 BMP9 can regulate tumor growth of osteosarcoma cells through the Wnt/beta-catenin pathway.
24072698 We demonstrate a cross-talk between BMPs and CRYAB and a major effect of this regulatory interaction on resistance to apoptosis.
24019898 results strongly suggest that Creld2 may be directly regulated by BMP9 and ER stress response may play an important role in regulating osteogenic differentiation
23972370 Mutations in BMP9 (also known as GDF2) were identified in three probands with hereditary hemorrhagic telangiectasia.
23936038 BMP9 signaling may be relevant during hepatocarcinogenesis in vivo.
23844832 the cross-talk between EGF and BMP9 signalling pathways in mesenchymal stem cells may underline their important roles in regulating osteogenic differentiation.
23807047 ResultS suggest that BMP9 may inhibit the migration and invasiveness of Osteosarcoma cells through a Smad-dependent pathway by downregulating the expression and activity of MMP9.
23313128 BMP-9 was able to induce the phosphorylation of Smad-1/5/8 and ERK 1/2 proteins, but did not induce p38 phosphorylation.
23018639 BMP9 regulates the SDF1/CXCR4 axis in endothelial cells. BMP9 signaling via endoglin switches cells from an SDF1-responsive autocrine state to an SDF1-nonresponsive paracrine state repressing endothelial cell migration & promoting vessel maturation.
22948234 the enhanced expression of BMP-9 in osteosarcoma cells by adBMP-9 exerted inhibitory effects on growth and migration of osteosarcoma cells possibly via blockade of the PI3K/AKT signaling pathway.
22829878 SNPs in the BMP9 gene appear to contribute to the risk of OPLL in association with certain clinical and demographic characteristics.
22556408 platelets regulate blood/lymphatic vessel separation by inhibiting the proliferation, migration, and tube formation of LECs, mainly because of the release of BMP-9 upon activation by CLEC-2/podoplanin in
22493445 data suggest that both the VEGF/VEGF receptor and the BMP9/ALK1 pathways are essential for stimulating angiogenesis, and targeting both pathways simultaneously may be an attractive strategy to overcome resistance to antiangiogenesis therapy
22474252 Mutual regulation by BMP-9 and CV2 is essential in regulating the development of the vascular endothelium.
22299030 Increased ET-1 production by endothelial cells as a consequence of BMPR II dysfunction may be clinically relevant in the pathogenesis of pulmonary arterial hypertension.
21737454 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21710321 BMP9 was produced by human hepatocytes and intrahepatic biliary epithelial cells.BMP9 circulates in plasma as an unprocessed inactive form that can be further activated by furin a serine endoprotease, and as a mature and fully active form
21695154 BMP9 administration can prevent lesion-evoked impairment of the cholinergic septohippocampal neurons in adult mice
20734064 Observational study of gene-disease association. (HuGE Navigator)
20406889 induces proliferation of multiple types of endothelial cells and promotes tumor angiogenesis in a xenograft mouse model
20398908 Observational study of gene-disease association. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19996292 BMP9 acts as a proliferative factor for immortalized ovarian surface epithelial cells and ovarian cancer cell lines, signaling predominantly through an ALK2/Smad1/Smad4 pathway, the major BMP9 receptor in endothelial cells.
19366699 Critical role of type II receptors in balancing BMP9 signaling via ALK1 and emphasize the essential role for BMPR-II in a subset of BMP9 responses in pulmonary artery endothelial cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18986983 Hey1 and Runx2 were shown to act synergistically in BMP9-induced osteogenic differentiation, and Runx2 expression significantly decreased in the absence of Hey1, suggesting that Runx2 may function downstream of Hey1
18922975 BMP-9 induced apoptosis in PC-3 cells through the up-regulation of prostate apoptosis response-4.
18309101 BMP9, circulating under a biologically active form, is a potent antiangiogenic factor that is likely to play a physiological role in the control of adult blood vessel quiescence
17549388 BMP-9 regulates the interaction of IGF-1 with growth plate chondrocytes.
17311849 These results suggest that BMP-9 is a physiological ALK1 ligand that plays an important role in the regulation of angiogenesis.
17068149 Bone Morphogenetic Protein 9 (BMP9) and BMP10 are two specific activin receptor-like kinase 1 ligands
16385451 Observational study of gene-disease association. (HuGE Navigator)
15851468 ALK-1, an orphan receptor in the TGF-beta family, is a potential receptor for BMP-9
11748585 promotes chondrogenic differentiation of multipotential mesenchymal cells

AA Sequence

MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLENVKVDFLRSL      1 - 70
NLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISITATEDFPFQKHILLFNISIP     71 - 140
RHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSA    141 - 210
VKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQ    211 - 280
ESVLKKLSKDGSTEAGESSHEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKE    281 - 350
YEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG    351 - 420
MSVAECGCR                                                                 421 - 429
//

Text Mined References (60)

PMID Year Title
26678910 2015 Epigenetic Regulation of GDF2 Suppresses Anoikis in Ovarian and Breast Epithelia.
26677222 2016 Rapid Activation of Bone Morphogenic Protein 9 by Receptor-mediated Displacement of Pro-domains.
26645636 2016 IGF1 potentiates BMP9-induced osteogenic differentiation in mesenchymal stem cells through the enhancement of BMP/Smad signaling.
26609524 2015 Synergistic Effects of BMP9 and miR-548d-5p on Promoting Osteogenic Differentiation of Mesenchymal Stem Cells.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
25909848 2015 BMP9 Crosstalk with the Hippo Pathway Regulates Endothelial Cell Matricellular and Chemokine Responses.
25751889 2015 Structure of bone morphogenetic protein 9 procomplex.
25393508 2014 Potential roles of BMP9 in liver fibrosis.
25297851 2015 BMP-9 regulates the osteoblastic differentiation and calcification of vascular smooth muscle cells through an ALK1 mediated pathway.
25237187 2014 Regulation of bone morphogenetic protein 9 (BMP9) by redox-dependent proteolysis.
25209393 2014 BMP9 regulates cross-talk between breast cancer cells and bone marrow-derived mesenchymal stem cells.
24805814 2014 BMP9 inhibits proliferation and metastasis of HER2-positive SK-BR-3 breast cancer cells through ERK1/2 and PI3K/AKT pathways.
24670474 2014 Potential roles of bone morphogenetic protein (BMP)-9 in human liver diseases.
24413988 2014 BMP9 inhibits the bone metastasis of breast cancer cells by downregulating CCN2 (connective tissue growth factor, CTGF) expression.
24337584 2014 Bone morphogenetic protein 9 regulates tumor growth of osteosarcoma cells through the Wnt/?-catenin pathway.
24072698 2013 Bone morphogenetic proteins protect pulmonary microvascular endothelial cells from apoptosis by upregulating ?-B-crystallin.
24019898 2013 Endoplasmic reticulum (ER) stress inducible factor cysteine-rich with EGF-like domains 2 (Creld2) is an important mediator of BMP9-regulated osteogenic differentiation of mesenchymal stem cells.
23972370 2013 BMP9 mutations cause a vascular-anomaly syndrome with phenotypic overlap with hereditary hemorrhagic telangiectasia.
23936038 2013 BMP9 is a proliferative and survival factor for human hepatocellular carcinoma cells.
23844832 2013 Cross-talk between EGF and BMP9 signalling pathways regulates the osteogenic differentiation of mesenchymal stem cells.
23807047 2013 Bone morphogenetic protein 9 overexpression reduces osteosarcoma cell migration and invasion.
23313128 2013 Bone morphogenetic protein-9 activates Smad and ERK pathways and supports human osteoclast function and survival in vitro.
23300529 2012 Endoglin requirement for BMP9 signaling in endothelial cells reveals new mechanism of action for selective anti-endoglin antibodies.
23018639 2012 BMP9 regulates endoglin-dependent chemokine responses in endothelial cells.
22948234 2012 Adenovirus-mediated overexpression of BMP-9 inhibits human osteosarcoma cell growth and migration through downregulation of the PI3K/AKT pathway.
22829878 2012 Association of a BMP9 haplotype with ossification of the posterior longitudinal ligament (OPLL) in a Chinese population.
22799562 2012 Structure of the Alk1 extracellular domain and characterization of its bone morphogenetic protein (BMP) binding properties.
22718755 2012 Specificity and structure of a high affinity activin receptor-like kinase 1 (ALK1) signaling complex.
22556408 2012 Platelet activation receptor CLEC-2 regulates blood/lymphatic vessel separation by inhibiting proliferation, migration, and tube formation of lymphatic endothelial cells.
22493445 2012 Anti-human activin receptor-like kinase 1 (ALK1) antibody attenuates bone morphogenetic protein 9 (BMP9)-induced ALK1 signaling and interferes with endothelial cell sprouting.
22474252 2012 Crossveinless 2 regulates bone morphogenetic protein 9 in human and mouse vascular endothelium.
22347366 2012 Structural and functional insights into endoglin ligand recognition and binding.
22299030 2012 BMP-9 induced endothelial cell tubule formation and inhibition of migration involves Smad1 driven endothelin-1 production.
21737454 2011 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21710321 2012 BMP9 is produced by hepatocytes and circulates mainly in an active mature form complexed to its prodomain.
21695154 2011 BMP9 protects septal neurons from axotomy-evoked loss of cholinergic phenotype.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20406889 2010 BMP-9 induces proliferation of multiple types of endothelial cells in vitro and in vivo.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19996292 2009 Autocrine bone morphogenetic protein-9 signals through activin receptor-like kinase-2/Smad1/Smad4 to promote ovarian cancer cell proliferation.
19903896 2010 ALK1 signaling regulates early postnatal lymphatic vessel development.
19366699 2009 Bone morphogenetic protein (BMP) and activin type II receptors balance BMP9 signals mediated by activin receptor-like kinase-1 in human pulmonary artery endothelial cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18986983 2009 Hey1 basic helix-loop-helix protein plays an important role in mediating BMP9-induced osteogenic differentiation of mesenchymal progenitor cells.
18922975 2008 Bone morphogenetic protein-9 induces apoptosis in prostate cancer cells, the role of prostate apoptosis response-4.
18309101 2008 Bone morphogenetic protein-9 is a circulating vascular quiescence factor.
17549388 2007 Bone morphogenetic protein-2 and -9 regulate the interaction of insulin-like growth factor-I with growth plate chondrocytes.
17311849 2007 BMP-9 signals via ALK1 and inhibits bFGF-induced endothelial cell proliferation and VEGF-stimulated angiogenesis.
17068149 2007 Identification of BMP9 and BMP10 as functional activators of the orphan activin receptor-like kinase 1 (ALK1) in endothelial cells.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15851468 2005 Crystal structure of BMP-9 and functional interactions with pro-region and receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748585 2001 BMP-2 and BMP-9 promotes chondrogenic differentiation of human multipotential mesenchymal cells and overcomes the inhibitory effect of IL-1.
10894782 2000 Induction and maintenance of the neuronal cholinergic phenotype in the central nervous system by BMP-9.
10849432 2000 Bone morphogenetic protein-9. An autocrine/paracrine cytokine in the liver.