Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.22
PubTator Score 270.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 5.8e-03
astrocytic glioma -1.100 1.3e-02
Breast cancer 2.300 3.0e-02
dermatomyositis -1.700 6.0e-03
ependymoma -1.500 2.0e-02
group 4 medulloblastoma -1.300 2.3e-05
juvenile dermatomyositis -1.165 4.9e-06
lung adenocarcinoma 1.859 4.0e-07
osteosarcoma -1.261 2.9e-04
ovarian cancer 1.100 2.2e-03
ulcerative colitis -1.200 2.1e-07

Gene RIF (15)

AA Sequence

MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAH      1 - 70
RGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPA     71 - 140
ANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVI    141 - 210
YKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDF    211 - 280
VSPAYLKKWSAKGIQVVGWTVNTFDEKSYYESHLGSSYITDSMVEDCEPHF                       281 - 331
//

Text Mined References (22)

PMID Year Title