Property Summary

NCBI Gene PubMed Count 18
PubMed Score 37.25
PubTator Score 25.68

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVG      1 - 70
ISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYE     71 - 140
DGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE                                         141 - 173
//

Text Mined References (21)

PMID Year Title