Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-05
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.986 1.2e-05

Synonym

Accession Q5JQS6 B2R4Y5 B3KX46 Q5JQT3
Symbols C1orf150

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYT      1 - 70
VINHIPHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH          71 - 135
//

Text Mined References (8)

PMID Year Title