Property Summary

NCBI Gene PubMed Count 2
PubMed Score 18.41
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute myeloid leukemia 783 1.1e-02

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.600 1.1e-02

AA Sequence

MSQLRATKSGLVVRAVICIFIFLYLRNPTPAESEEEPAQPEVVECGFYPDELCSALFEGKGAAPQIAKFC      1 - 70
KTPHKSEIHAHLHTPGNCSRISRGLHFITRPLSAEEGDFSLAYIITIHKELAMFVQLLRAIYVPQNVYCI     71 - 140
HVDEKAPMKYKTAVQTLVNCFENVFISSKTEKVAYAGFTRLQADINCMKVLVHSKFQWNYVINLCGQDFP    141 - 210
IKTNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPPHNLTIYFGSA    211 - 280
YYVLTRKFVEFILTDIHAKDMLQWSKDIRSPEQHYWVTLNRLKDAPGATPNAGWEGNVRAIKRKSEEGNV    281 - 350
HDGCKGRYVEDICVYGPGDLPWLIQSPSLFANKFEPSTDPLVVTCLERRHRLQVLRQAEVPIEPHWHFQQ    351 - 420
QSHFNMRLNR                                                                421 - 430
//

Text Mined References (4)

PMID Year Title