Property Summary

NCBI Gene PubMed Count 2
PubMed Score 33.08
PubTator Score 1.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.1e-115
lung adenocarcinoma 2714 1.0e-12
lung cancer 4473 3.3e-04
uncontrolled asthma 67 2.7e-03
Disease Target Count Z-score Confidence
Mast cell neoplasm 7 4.803 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
uncontrolled asthma 1.800 2.7e-03
lung cancer -1.700 3.3e-04
lung adenocarcinoma -1.300 1.0e-12
psoriasis 2.100 3.1e-115

Protein-protein Interaction (11)

AA Sequence

MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRYTHVKDEVRYE      1 - 70
VNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYAQKLVSKEEKSFPIAYSLVVH     71 - 140
KDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCL    141 - 210
SDLLKSSIQWKYVINLCGQDFPLKSNFELVSELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVK    211 - 280
LPIRTNISKEAPPHNIQIFVGSAYFVLSQAFVKYIFNNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPG    281 - 350
EISRSAQDVSDLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPIL    351 - 420
IKCLAEKLEEQQRDWITLPSEKLFMDRNLTTTS                                         421 - 453
//

Text Mined References (2)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
10753916 2000 Control of O-glycan branch formation. Molecular cloning and characterization of a novel thymus-associated core 2 beta1, 6-n-acetylglucosaminyltransferase.