Property Summary

NCBI Gene PubMed Count 39
PubMed Score 91.86
PubTator Score 73.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (30)

PMID Text
26768364 GCNT1 expression in prostate biopsy specimen is a significant and independent predictor of recurrence after radical prostatectomy, which can be used in pre-treatment decision making for the patient.
26390303 GCNT1 expression in prostate cancer positively correlates with cancer progression and prostate-specific antigen recurrence.
25086069 Results show that ST3Gal1 uses GM130-GRASP65 and giantin, whereas C2GnT-L uses only giantin for Golgi targeting and defective giantin dimerization in PC-3 and DU145 prostate cancer cells causes fragmentation of the Golgi and prevents its targeting.
24854630 GCNT1 is over-expressed in prostate cancer and is associated with higher levels of core 2 O-sLe(x) in PSA, PAP and MUC1 proteins.
23990450 NMIIA is the master regulator of Golgi fragmentation induced by heat shock or inhibition/depletion of HSP70/90 through interaction with gylosyltransferases.
23617619 Immunohistochemical expression of core 2 beta1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma may be a novel potential prognostic factor.
23165940 C2GnT-expressing prostate cancer cells evade NK cell immunity and survive longer in the host blood circulation, thereby resulting in the promotion of prostate cancer metastasis.
23027862 GOLPH3 can regulate cell-cell interaction by controlling Golgi retention of C2GnT1.
22534569 Down-regulation of C2GnT1 is correlated with breast cancer
22056345 The X-ray crystal structure (2.3 A resolution) of a mutant form of C2GnT-L (C217S) in complex with UDP was solved. C2GnT-L exists in an "open" conformation and a "closed" conformation.
21712812 In C2GnT-expressing bladder tumour cells galectin-3 bound the NKG2D-binding site of MICA, reducing the affinity of MICA for NKG2D on natural killer cells and hence severely impairing natural killer cell activation.
21081110 Data show that the reconstituted membrane system in cells expressing C2GnT-I led to the lipid vesicles exhibiting an enzyme activity 11 times higher than that found in microsomal membranes.
20841351 Core2 O-glycan structure is essential for expression of SI and DDP-IV during intestinal cell differentiation.
20017138 Overexpression of C2GnT-1 enhances the metastatic potential of testicular germ cell tumor.
19524017 Data show that a short glycopeptide Galbeta1-3GalNAcalpha-TAGV was identified as an efficient C2GnT substrate.
19267921 15-fold increase in C2GnT1 mRNA levels in colorectal adenocarcinomas compared to normal colorectal tissues
18815556 Pancreas carcinoma antigen, C2GnT, fused to invariant chain elicits T-cell response and tumor growth inhibition.
17947642 regulation of O-glycosylation controls sLe(x) expression, and also suggest that O-glycans may have a function in dendritic cells migration
17530395 2 beta1,6 N-acetylglucosaminyltransferase-I transcription is regulated by Sp1 in lymphocytes and epithelial cells
16778138 glycosyltransferase haploinsufficiency results in altered cellular glycosylation and resistance to cell death, identifying a new survival mechanism for T-lymphoma cells
16179912 C2GnT-1 regulates selectin ligand expression; downregulation of the selectin ligand expression level inhibits tissue infiltration of BCP-leukemia cells
15932919 Core2GnT is an extremely useful prognostic marker for prostate cancer progression. Acquiring Core2GnT in prostate carcinoma cells facilitates adhesion to type IV collagen and laminin causing aggressive tumor formation by prostate cancer cells.
15926890 A differential functional impact of N-glycosylation on C2GnT-1 and FucT-VII and disclose that a strongly reduced FucT-VII activity retains the ability to fucosylate PSGL-1 on the core2-based binding site(s) for the three selectins.
15882971 A/G polymorphism in enzyme is associated with the susceptibility to prostate cancer in a Japanese population
15591039 upregulated by all-trans retinoic acid (RA) and by IL-4 and IL-13 in the H292 airway epithelial cell line
15483269 C2GnT-1 regulates sLeX expression level during differentiation of pre-B cells
15026421 core 2 beta1-6-N-glucosaminyltransferase and dimerization of P-selectin glycoprotein ligand-1 have roles in rolling on P-selectin
12765965 elevated glucose increases the activity of core 2 GlcNAc-T and adhesion of human leukocytes to retinal capillary endothelial cells, in a dose-dependent manner, through diabetes-activated serine/threonine protein kinase C beta2-dependent phosphorylation
12626388 presence of multiple tissue-specific promoters for the C2GnT I gene
12600830 EGF suppressed C2GnT activity in a time- and dose-dependent fashion, and also suppressed core 4 beta1,6 N-acetylglucosaminyltransferase (C4GnT) activity

AA Sequence

MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCTKVLQGDVNEI      1 - 70
QKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLL     71 - 140
RAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANW    141 - 210
KYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET    211 - 280
PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV    281 - 350
ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH    351 - 420
KALETLKH                                                                  421 - 428
//

Text Mined References (41)

PMID Year Title
26768364 2016 Core 2 ?-1, 6-N-acetylglucosaminyltransferase-1 expression in prostate biopsy specimen is an indicator of prostate cancer aggressiveness.
26390303 2015 Detection of Core2 ?-1,6-N-Acetylglucosaminyltransferase in Post-Digital Rectal Examination Urine Is a Reliable Indicator for Extracapsular Extension of Prostate Cancer.
25086069 2014 Restoration of compact Golgi morphology in advanced prostate cancer enhances susceptibility to galectin-1-induced apoptosis by modifying mucin O-glycan synthesis.
24854630 2014 Increased expression of GCNT1 is associated with altered O-glycosylation of PSA, PAP, and MUC1 in human prostate cancers.
23990450 2014 Golgi fragmentation induced by heat shock or inhibition of heat shock proteins is mediated by non-muscle myosin IIA via its interaction with glycosyltransferases.
23617619 2013 Immunohistochemical expression of core 2 ?1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma: a novel potential prognostic factor.
23165940 2013 Core2 O-glycan-expressing prostate cancer cells are resistant to NK cell immunity.
23027862 2012 Golgi phosphoprotein 3 determines cell binding properties under dynamic flow by controlling Golgi localization of core 2 N-acetylglucosaminyltransferase 1.
22534569 2012 MUC1 in human and murine mammary carcinoma cells decreases the expression of core 2 ?1,6-N-acetylglucosaminyltransferase and ?-galactoside ?2,3-sialyltransferase.
22056345 2011 Structural and mechanistic characterization of leukocyte-type core 2 ?1,6-N-acetylglucosaminyltransferase: a metal-ion-independent GT-A glycosyltransferase.
21712812 2011 A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21081110 2011 A glycosyltransferase-enriched reconstituted membrane system for the synthesis of branched O-linked glycans in vitro.
20841351 2010 Core2 O-glycan structure is essential for the cell surface expression of sucrase isomaltase and dipeptidyl peptidase-IV during intestinal cell differentiation.
20017138 2010 Core 2 N-acetylglucosaminyltransferase-1 expression induces aggressive potential of testicular germ cell tumor.
19524017 2009 Site directed processing: role of amino acid sequences and glycosylation of acceptor glycopeptides in the assembly of extended mucin type O-glycan core 2.
19267921 2009 The high affinity selectin glycan ligand C2-O-sLex and mRNA transcripts of the core 2 beta-1,6-N-acetylglucosaminyltransferase (C2GnT1) gene are highly expressed in human colorectal adenocarcinomas.
18815556 2008 Pancreas carcinoma antigen fused to invariant chain elicits T-cell response and tumor growth inhibition.
17947642 2007 Sialyl-Lewis(x) on P-selectin glycoprotein ligand-1 is regulated during differentiation and maturation of dendritic cells: a mechanism involving the glycosyltransferases C2GnT1 and ST3Gal I.
17530395 2007 Control of core 2 beta1,6 N-acetylglucosaminyltransferase-I transcription by Sp1 in lymphocytes and epithelial cells.
16778138 2006 Haploinsufficiency of C2GnT-I glycosyltransferase renders T lymphoma cells resistant to cell death.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16179912 2005 Transfection of antisense core 2 beta1,6-N-acetylglucosaminyltransferase-1 cDNA suppresses selectin ligand expression and tissue infiltration of B-cell precursor leukemia cells.
15932919 2005 Expression of core 2 beta1,6-N-acetylglucosaminyltransferase facilitates prostate cancer progression.
15926890 2005 N-glycans of core2 beta(1,6)-N-acetylglucosaminyltransferase-I (C2GnT-I) but not those of alpha(1,3)-fucosyltransferase-VII (FucT-VII) are required for the synthesis of functional P-selectin glycoprotein ligand-1 (PSGL-1): effects on P-, L- and E-selectin binding.
15882971 2005 An A/G polymorphism of core 2 branching enzyme gene is associated with prostate cancer.
15591039 2005 Mucin biosynthesis: upregulation of core 2 beta 1,6 N-acetylglucosaminyltransferase by retinoic acid and Th2 cytokines in a human airway epithelial cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483269 2005 Not core 2 beta 1,6-N-acetylglucosaminyltransferase-2 or -3 but -1 regulates sialyl-Lewis x expression in human precursor B cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15026421 2004 Functional analysis of the combined role of the O-linked branching enzyme core 2 beta1-6-N-glucosaminyltransferase and dimerization of P-selectin glycoprotein ligand-1 in rolling on P-selectin.
12765965 2003 Protein kinase C beta2-dependent phosphorylation of core 2 GlcNAc-T promotes leukocyte-endothelial cell adhesion: a mechanism underlying capillary occlusion in diabetic retinopathy.
12626388 2003 Multiple transcription initiation and alternative splicing in the 5' untranslated region of the core 2 beta1-6 N-acetylglucosaminyltransferase I gene.
12600830 2003 Mucin biosynthesis: epidermal growth factor downregulates core 2 enzymes in a human airway adenocarcinoma cell line.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9915862 1999 Molecular cloning and expression of a novel beta-1, 6-N-acetylglucosaminyltransferase that forms core 2, core 4, and I branches.
9278427 1997 Altered Golgi localization of core 2 beta-1,6-N-acetylglucosaminyltransferase leads to decreased synthesis of branched O-glycans.
8449405 1993 Expression of the developmental I antigen by a cloned human cDNA encoding a member of a beta-1,6-N-acetylglucosaminyltransferase gene family.
7579796 1995 Genomic organization of core 2 and I branching beta-1,6-N-acetylglucosaminyltransferases. Implication for evolution of the beta-1,6-N-acetylglucosaminyltransferase gene family.
1329093 1992 Expression cloning of a cDNA encoding UDP-GlcNAc:Gal beta 1-3-GalNAc-R (GlcNAc to GalNAc) beta 1-6GlcNAc transferase by gene transfer into CHO cells expressing polyoma large tumor antigen.