Property Summary

NCBI Gene PubMed Count 5
PubMed Score 17.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.370 3.2e-04
posterior fossa group B ependymoma -1.300 8.9e-06
atypical teratoid / rhabdoid tumor -1.700 8.6e-07
glioblastoma -1.300 8.7e-05
medulloblastoma -1.200 6.6e-03
medulloblastoma, large-cell -2.000 1.9e-05
adrenocortical carcinoma -1.290 4.1e-02
tuberculosis and treatment for 3 months -1.400 3.4e-06
intraductal papillary-mucinous neoplasm ... 1.100 9.2e-03
adult high grade glioma -1.300 5.8e-04
pituitary cancer -1.200 2.3e-03

AA Sequence

MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPK      1 - 70
RQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPD     71 - 140
DNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVPDDNSDDSSDDNSDDSSDDNSD    141 - 210
DSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSD    211 - 280
DSEASDDSSDDSEASDDSSDDSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASD    281 - 350
EEELVEAAAAVSQHDSSDDAGEQDLGENLSKPPSDPEANPEVSERKLPTEEEPAPVVEQSGKRKSKTKTI    351 - 420
VEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHKKRGPSKKKPGAAKVEKRKTRT    421 - 490
PKCKVPGCFLQDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTG    491 - 560
EMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRV    561 - 630
TRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV             631 - 691
//

Text Mined References (6)

PMID Year Title
27718356 2016 A widely employed germ cell marker is an ancient disordered protein with reproductive functions in diverse eukaryotes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714101 2001 ACRC codes for a novel nuclear protein with unusual acidic repeat tract and maps to DYT3 (dystonia parkinsonism) critical interval in xq13.1.