Property Summary

NCBI Gene PubMed Count 5
PubMed Score 20.42
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.290 4.1e-02
adult high grade glioma -1.300 5.8e-04
atypical teratoid / rhabdoid tumor -1.700 8.6e-07
ependymoma -1.200 5.0e-06
glioblastoma -1.300 8.7e-05
group 4 medulloblastoma -1.200 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.2e-03
medulloblastoma, large-cell -2.000 1.9e-05
osteosarcoma -1.370 3.2e-04
pituitary cancer -1.200 2.3e-03
tuberculosis -1.200 3.4e-06

Synonym

Accession Q96QF7 B9EG62
Symbols ACRC
NAAR1

Gene

  Ortholog (2)

Species Source Disease
OMA EggNOG
OMA EggNOG

AA Sequence

MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPK      1 - 70
RQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPD     71 - 140
DNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVPDDNSDDSSDDNSDDSSDDNSD    141 - 210
DSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSD    211 - 280
DSEASDDSSDDSEASDDSSDDSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASD    281 - 350
EEELVEAAAAVSQHDSSDDAGEQDLGENLSKPPSDPEANPEVSERKLPTEEEPAPVVEQSGKRKSKTKTI    351 - 420
VEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHKKRGPSKKKPGAAKVEKRKTRT    421 - 490
PKCKVPGCFLQDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTG    491 - 560
EMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRV    561 - 630
TRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV             631 - 691
//

Text Mined References (6)

PMID Year Title