Property Summary

NCBI Gene PubMed Count 40
PubMed Score 63.58
PubTator Score 50.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (32)

PMID Text
26769961 GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization.
26503785 reveals a positive feedback loop between glial cells missing 1 and Human chorionic gonadotropin regulating placental hCGbeta expression and cell differentiation
23651062 study reveals a novel function for RACK1 to regulate GCM1 activity and placental cell migration and invasion
23610556 Gcm1 and Fzd5 function in an evolutionary conserved positive feedback loop that regulates trophoblast differentiation and sites of chorionic branching morphogenesis.
23580611 Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development.
23438603 c-Myc-regulated members of the miR-17~92 and miR-106a~363 clusters inhibit trophoblast differentiation by repressing GCM1 and CYP19A1.
23300953 GCM1-directed villous trophoblast differentiation is repressed by DREAM
22975632 Phorbol 12-myristate 13-acetate-induced protein kinase C and mitogen-activated protein kinase kinase/extracellular signal regulated kinase dependent pathway enhances the degradation as well as the transcriptional activity of GCMa.
22778138 study reveals a novel function of GCM1 and HtrA4 in regulation of trophoblast invasion and that abnormal HrtA4 expression may contribute to shallow trophoblast invasion in preeclampsia
22275534 results support a role for reduced placental Gcm1 expression as a causative factor in defective syncytiotrophoblast differentiation and maternal and placental phenotypes in preeclampsia in humans.
22206674 these data demonstrate for the first time that GCMa is phosphorylated by the PKC- and MEK/extracellular signal-regulated kinase (ERK)-dependent mechanism, and that this phosphorylation is involved in its degradation process.
22109522 Data show that beta-catenin/BCL9-Like (BCL9L)/T-cell factor 4 (TCF4) signalling directly targets the GCM1/syncytin pathway and thereby regulates the fusion of human choriocarcinoma cells.
21791615 Our study has identi fi ed a novel cAMP/Epac1/CaMKI/GCM1 signaling cascade that stimulates trophoblast fusion through promoting GCM1 phosphorylation and desumoylation.
21406447 TIMP4 is a downstream target of GCM1.
20484742 Our results suggest that GCM1 is a critical factor in controlling placental cell fusion through transcriptional regulation of syncytin 2 and MFSD2A gene expression in placenta.
19890582 The researchers found evidence that GCM1 is a potential susceptibility or marker gene for IGA nephropathy.
19890582 Observational study of gene-disease association. (HuGE Navigator)
19692500 CD9 increases GCM1 expression via the cAMP/PKA signaling pathway, resulting in the increase in ERVWE1 expression.
19321927 Severe hypoxia is associated with reduced GCMa and syncytin-1 transcripts and altered fusion of primary trophoblasts.
19219068 A central role for GCM1 protein in mediating the differentiation of trophoblast cells along both the villous and extravillous pathways in human placental development.
19204726 Observational study of gene-disease association. (HuGE Navigator)
18703417 UBE2D2 is required for GCMa ubiquitination and for association with the SCF(FBXW2) complex.
18160678 Ther is a functional role for GCM1 contributing to constitutively high trophoblast PGF expression and is the first direct evidence of an oxygen-responsive, trophoblast-specific transcription factor contributing to the regulation of PGF expression.
17646165 GCMa is a new sumoylation substrate and its activity is down-regulated by sumoylation.
16594548 Plasma placenta-specific 1 and GCM1 mRNAs appear promising as noninvasively measurable molecular markers for pre-eclampsia
16528103 Results suggests that histone deacetylase 3 can functionally attenuate the CBP-upregulated GCMa activity in the activated signaling pathway leading to placental cell fusion.
16166624 GCMa acetylation is mediated by CBP, which stimulates GCMa transcriptional activity through cyclic AMP/protein kinase A signaling
16004993 GCMa-driven syncytin expression is the key mechanism for syncytiotrophoblast formation
15640526 the SCF(hFBW2) E3 complex has a key role in targeting hGCMa to the ubiquitin-proteasome degradation system
15135239 GCM1 transcription factor expression is regulated both at the transcriptional and translational level and these studies show that the general features of GCM1 mRNA and protein expression in the human placenta are conserved with the mouse
15081636 Results suggest that GCM1 is a distinct transcription factor involved in placental disease and altered expression of the GCM1 gene may contribute to the etiology of pre-eclampsia.
12397062 GCMa regulates the syncytin-mediated trophoblastic fusion in human cells

AA Sequence

MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSR      1 - 70
ILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHD     71 - 140
GRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQE    141 - 210
GVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLL    211 - 280
PPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKT    281 - 350
GCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG    351 - 420
LDHCNNDMLLNLCPLR                                                          421 - 436
//

Text Mined References (40)

PMID Year Title
26769961 2016 Glioma-associated Oncogene 2 Is Essential for Trophoblastic Fusion by Forming a Transcriptional Complex with Glial Cell Missing-a.
26503785 2016 A Positive Feedback Loop between Glial Cells Missing 1 and Human Chorionic Gonadotropin (hCG) Regulates Placental hCG? Expression and Cell Differentiation.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23651062 2013 RACK1 (receptor for activated C-kinase 1) interacts with FBW2 (F-box and WD-repeat domain-containing 2) to up-regulate GCM1 (glial cell missing 1) stability and placental cell migration and invasion.
23610556 2013 A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
23580611 2013 Caspase-14 suppresses GCM1 acetylation and inhibits placental cell differentiation.
23438603 2013 The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation.
23300953 2013 DREAM mediated regulation of GCM1 in the human placental trophoblast.
22975632 2012 PMA-induced GCMa phosphorylation stimulates its transcriptional activity and degradation.
22778138 2012 High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion.
22275534 2012 Effects of reduced Gcm1 expression on trophoblast morphology, fetoplacental vascularity, and pregnancy outcomes in mice.
22206674 2012 PMA induces GCMa phosphorylation and alters its stability via the PKC- and ERK-dependent pathway.
22109522 2011 Identification of a link between Wnt/?-catenin signalling and the cell fusion pathway.
21791615 2011 A novel cyclic AMP/Epac1/CaMKI signaling cascade promotes GCM1 desumoylation and placental cell fusion.
21406447 2011 Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi.
20484742 2010 GCM1 regulation of the expression of syncytin 2 and its cognate receptor MFSD2A in human placenta.
19890582 2009 Parallel genotyping of 10,204 single nucleotide polymorphisms to screen for susceptible genes for IgA nephropathy.
19692500 2009 CD9 regulates transcription factor GCM1 and ERVWE1 expression through the cAMP/protein kinase A signaling pathway.
19321927 2009 Syncytin-1 and glial cells missing a: hypoxia-induced deregulated gene expression along with disordered cell fusion in primary term human trophoblasts.
19219068 2009 Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18703417 2008 Ubiquitin-conjugating enzyme UBE2D2 is responsible for FBXW2 (F-box and WD repeat domain containing 2)-mediated human GCM1 (glial cell missing homolog 1) ubiquitination and degradation.
18160678 2008 Glial cell missing 1 regulates placental growth factor (PGF) gene transcription in human trophoblast.
17646165 2007 Small ubiquitin-like modifier modification regulates the DNA binding activity of glial cell missing Drosophila homolog a.
16594548 2006 Increased plasma mRNAs of placenta-specific 1 (PLAC1) and glial cells-missing 1 (GCM1) in mothers with pre-eclampsia.
16528103 2006 Histone deacetylase 3 binds to and regulates the GCMa transcription factor.
16166624 2005 Stimulation of GCMa transcriptional activity by cyclic AMP/protein kinase A signaling is attributed to CBP-mediated acetylation of GCMa.
16004993 2005 Stimulation of GCMa and syncytin via cAMP mediated PKA signaling in human trophoblastic cells under normoxic and hypoxic conditions.
15640526 2005 FBW2 targets GCMa to the ubiquitin-proteasome degradation system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385555 2004 Interaction, cooperative promoter modulation, and renal colocalization of GCMa and Pitx2.
15135239 2004 Complex patterns of GCM1 mRNA and protein in villous and extravillous trophoblast cells of the human placenta.
15081636 2004 Decreased placental GCM1 (glial cells missing) gene expression in pre-eclampsia.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397062 2002 GCMa regulates the syncytin-mediated trophoblastic fusion.
11071865 2000 Genomic organization, chromosomal localization, and the complete 22 kb DNA sequence of the human GCMa/GCM1, a placenta-specific transcription factor gene.
10858268 2000 Placental expression and chromosomal localization of the human Gcm 1 gene.
10542267 1999 A GCM motif protein is involved in placenta-specific expression of human aromatase gene.
8962155 1996 The gcm-motif: a novel DNA-binding motif conserved in Drosophila and mammals.