Property Summary

NCBI Gene PubMed Count 95
PubMed Score 266.17
PubTator Score 453.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphocytic leukemia 1.338 2.0e-03
urothelial carcinoma -1.100 4.7e-02
psoriasis 1.800 6.5e-04
osteosarcoma -1.308 3.1e-03
atypical teratoid / rhabdoid tumor -1.700 4.5e-06
glioblastoma -1.200 6.4e-03
pancreatic ductal adenocarcinoma liver m... -1.301 3.0e-02
non-small cell lung cancer 2.402 1.9e-15
lung cancer 3.600 5.3e-06
interstitial cystitis -1.800 3.5e-05
lung adenocarcinoma 1.200 9.5e-05
lung carcinoma 1.300 3.1e-11
ovarian cancer -1.200 6.4e-03
pituitary cancer 1.800 1.8e-06
Down syndrome 1.400 1.1e-03
chronic rhinosinusitis -1.460 4.1e-02

Protein-protein Interaction (5)

Gene RIF (82)

PMID Text
26365678 Data suggest expression of hepatocyte GCLC and GCLM can be regulated by dietary component; alpha-lipoic acid, a vitamin B complex nutrient, protects against oxidative stress/cytotoxicity induced by cadmium via restoration of GCLC and GCLM expression.
26087411 Cigarette smoke-induced hypermethylation of the GCLC promoter is related to the initiation and progression of COPD.
26059756 GCLC and GSS were expressed at higher levels in colon cancer tissue, as compared with normal mucosa.
25353619 miR-433 targets both catalytic (GCLc) and regulatory (GCLm) subunits of GCL.
24665821 H2S upregulates GCLC and GSH and inhibits IL-1beta levels, which may be what mediates the beneficial effects of H2S-rich compounds in mitigating the pathogenesis of metabolic syndrome and atherosclerosis
24068433 the CYP1A1 (rs2606345, rs4646903, rs1048943), GCLC, AGT, and AGTR1 genes was associated with pleuritis, empyema, acute respiratory distress syndrome, all PC and acute respiratory failure (ARF).
23770363 1,25 (OH) vitamin D significantly upregulated expression of GCLC and GR and lowered secretion of IL-8 and MCP-1 in high-glucose exposed U937 monocytes.
23758905 Polymorphisms in GCLC, GSTM1, GSTT1, and GSTP1 genes associated with metabolism of glutathione act on cystic fibrosis severity.
23448276 These data strongly indicate a discrepancy between the regulation of GCLC and of GGT following the oxidative stress situation due to mitochondrial uncoupling.
23443115 The Kaplan-Meier analysis shows that rs3736729 on GCLC presents a significant association with disease-free survival and overall survival.
23255485 Genistein up-regulated HO-1 and Glutamate-Cysteine Ligase expression through the EKR1/2 and PKC /Nrf2 pathways during oxidative stress.
22824134 rs761142 in GCLC was found to be associated with reduced GCLC mRNA expression and with SMX-induced hypersensitivity in HIV/AIDS patients.
22610501 A functional trinucleotide repeat polymorphism in the 5'-untranslated region of the glutathione biosynthetic gene GCLC is associated with increased risk for lung and aerodigestive tract cancers.
22452920 Data suggest that microRNA/mRNA pairs in hsa-miR-140-3p/RAD51AP1/, hsa-miR-145/E2F3, hsa-miR-139-5p/TOP2A, and hsa-miR-133a/GCLC were correlated with ovarian tumorigenesis.
22249522 Data show for the first time that GCLC may serve a dual role, as a surrogate marker for cellular redox state as well as malignant potential of melanoma cells.
21962117 The functional SNPs CYBA -675 T --> A and GCLC rs17883901, probably associated with cellular redox imbalances, modulate the risk for renal disease in the studied population of type 1 diabetes patients
21871559 insulin increased GCLc promoter activity, which required a prerequisite increase or decrease in medium glucose
21657237 The impacts of four clinical missense mutations on GCLC enzymatic function in vivo and in vitro, was evaluated.
21555518 GCLC is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21444626 Results suggest that GAG polymorphism affects GCLC expression via translation, and thus may be associated with altered risk for GSH-related diseases and toxicities.
21438662 the single nucleotide polymorphism (SNP) -129C/T (rs17883901) in glutamate-cysteine ligase catalytic subunit (GCLC) and SNPs I128T (rs3816873) and Q95H (rs61733139) in microsomal triglyceride transfer protein (MTTP) in nonalcoholic fatty liver disease
21277635 SNPs not associated with self-reported depression
21156206 These results provide evidence that interaction of the two variations can efficiently impair GCLC expression and thus suggest its involvement in the pathogenesis of diseases related to GSH metabolism.
21105962 SNPs not associted with schizophrenia in Japanese individuals
20970495 Posttranslational modification and regulation of glutamate-cysteine ligase by the alpha,beta-unsaturated aldehyde 4-hydroxy-2-nonenal.
20732852 Data show that activation of the PPARgamma/PGC-1alpha pathway may protect against COPD progression by upregulating gamma-GCS and relieving oxidative stress.
20712757 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20673128 high-risk glutamate-cysteine ligase catalytic subunit GAG trinucleotide repeat genotypes lead to alterations of plasma thiols levels that reflect a dysregulation of redox control
20659789 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20655259 An ethnic-specific polymorphism in the catalytic subunit of glutamate-cysteine ligase impairs the production of glutathione intermediates in vitro.
20655259 Observational study of genotype prevalence. (HuGE Navigator)
20615707 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
20180881 Regulation of GCL(cat) by MYCN accounts for the survival of neuroblastoma cells against oxidative damage; GCL should be considered a potential therapeutic target for the treatment of MYCN-amplified neuroblastoma.
19817962 Polymorphisms of glutamate-cystein ligase and microsomal triglyceride transfer protein genes may be associated with non-alcoholic liver disease progression.
19817962 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567187 PD98059 and erythromycin could block AP-1 transduction pathway, but increase the synthesis of gamma-GCS induced by 4-hydroxynonenal in bronchial epithelial cells.
19515364 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19347979 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19041695 study of consequences of impaired glutathione synthesis, due to GAG trinucleotide repeat polymorphism in catalytic subunit of glutamate cysteine ligase, on regulation of the proteome; findings show altered proteome reaction in response to oxidative stress
18977241 Observational study of gene-disease association. (HuGE Navigator)
18926903 results support the functional importance of insulin in Nrf2-dependent transcriptional upregulation of GCLc in GSH recovery during oxidative challenge and suggest a possible role for hypoglycemia in promoting insulin-mediated GCLc upregulation
18560528 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18549827 decreasing trend of GCL activity was observed in the order of 7/7>7/9>9/9 (P=0.04)
18549827 Observational study of gene-disease association. (HuGE Navigator)
18420959 GCLC is a novel susceptibility gene for low level of lung function in copd
18420959 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18276794 Glutamate cysteine ligase iz induced by hydroxynonenal through the c-Jun N-terminal kinase (JNK) pathway in respiratory epithelium.
18066575 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18035085 Observational study of gene-disease association. (HuGE Navigator)
18035085 GCLC T allele, together with hypertension and male sex, is associated with cardiovascular events in our study population.
17961430 Observational study of gene-disease association. (HuGE Navigator)
17921251 Observational study of gene-disease association. (HuGE Navigator)
17643973 The -588TT/-23TT genotype was found to be associated with decreased risk of allergic asthma after adjustment for age, gender and smoking status using regression analysis (OR=0.33 95% CI 0.15-0.70, p=0.036) but with increased risk of non-allergic asthma.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17479437 Observational study of gene-disease association. (HuGE Navigator)
17479437 GCLC promoter polymorphisms may influence glutamate decarboxylase 65 autoantibody levels the age at which type 1 diabettes is diagnosed.
17344309 upregulation of gamma-glutamate-cysteine ligase as part of the long-term adaptation process to iron accumulation in neurons
17333241 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17207022 Observational study of gene-disease association. (HuGE Navigator)
17207022 The genetic polymorphism in GCLC -129C/T is not associated with susceptibility to COPD in a southern Chinese population of Han nationality.
17109620 Activation of insulin signaling through PI3K/Akt/mTOR/Nrf2/ GCLc pathway affords significant cell protection by maintaining cellular redox balance.
16766924 Observational study of gene-disease association. (HuGE Navigator)
16690975 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16690975 This study found an association between variants in GCLC, a novel candidate gene, and cystic fibrosis lung function; this effect was observed only in patients with a mild CFTR (cystic fibrosis transmembrane conductance regulator) genotype
16599007 Observational study of gene-disease association. (HuGE Navigator)
16491484 Drug-resistant cells have the inherent ability to maintain increased gamma-GCS activity.
16403949 Results suggest that TNF-alpha elevates the expression of lens epithelium-derived growth factor (LEDGF) and that LEDGF is one of the transactivators of gamma-glutamylcysteine synthetase heavy subunit gene.
16322067 Adrenomedullin regulates cellular glutathione content via modulation of gamma-glutamate-cysteine ligase catalytic subunit expression
15485876 data provide the first report of glutamylcysteine ligase (GCLC) expression in the islet and demonstrate that adenoviral overexpression of GCLC increases intracellular glutathione levels and protects the beta cell from adverse effects of IL-1 beta
15451055 Review. The most important element in both Gclc and Gclm expression is the electrophile response element in their promoters.
14676828 GCS is up-regulated by antiestrogens mediated by estrogen receptor beta.
12663448 A new gamma-GCSH mutation from gamma-GCS deficiency, a C>T missense mutation at nucleotide 379, encodes a predicted Arg127Cys amino acid change. The mutated amino acid lies within a cleft on the protein surface of gamma-GCSH, containing Cys249.
12598062 Observational study of gene-disease association. (HuGE Navigator)
12500194 redox-sensitive elements directing expression of the glutamate cysteine ligase in CYP2E1-expressing cells are present in the ARE4 distal portion of the 5'-flanking region, perhaps a reflection of metabolic adaptation to CYP2E1-generated oxidative stress.
12070177 identification of a variant antioxidant response element in the promoter region
11972604 Oxidant stress induces gamma-glutamylcysteine synthetase and glutathione synthesis in human bronchial epithelial NCI-H292 cells.
11844594 Genetic determinants of lung cancer short-term survival: the role of glutathione-related genes
11820781 Expression of the gamma-glutamylcysteine synthetase heavy subunit gene is inducible by certain nonsteroidal anti-inflammatory drugs (e.g., indomethacin) in colon cancer cells.

AA Sequence

MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLS      1 - 70
GEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQA     71 - 140
LCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRFSTLTRNIRHRRGEKVVINVPIFKD    141 - 210
KNTPSPFIETFTEDDEASRASKPDHIYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALS    211 - 280
AASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTI    281 - 350
DKEIYEQLLQEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI    351 - 420
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDI    421 - 490
CKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNSYLENMEVDVDTRCSILNYLK    491 - 560
LIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSG    561 - 630
SKTDSSN                                                                   631 - 637
//

Text Mined References (99)

PMID Year Title
26365678 2015 ?-Lipoic acid protects against the oxidative stress and cytotoxicity induced by cadmium in HepG2 cells through regenerating glutathione regulated by glutamate-cysteine ligase.
26087411 2016 Cigarette Smoke-Induced Hypermethylation of the GCLC Gene Is Associated With COPD.
26059756 2015 Involvement of glutathione and glutathione metabolizing enzymes in human colorectal cancer cell lines and tissues.
25353619 2015 Targeting of Gamma-Glutamyl-Cysteine Ligase by miR-433 Reduces Glutathione Biosynthesis and Promotes TGF-?-Dependent Fibrogenesis.
24665821 2014 Hydrogen sulfide upregulates glutamate-cysteine ligase catalytic subunit, glutamate-cysteine ligase modifier subunit, and glutathione and inhibits interleukin-1? secretion in monocytes exposed to high glucose levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24068433 2013 CYP1A1, GCLC, AGT, AGTR1 gene-gene interactions in community-acquired pneumonia pulmonary complications.
23770363 2013 Vitamin D upregulates glutamate cysteine ligase and glutathione reductase, and GSH formation, and decreases ROS and MCP-1 and IL-8 secretion in high-glucose exposed U937 monocytes.
23758905 2013 Genetic interaction of GSH metabolic pathway genes in cystic fibrosis.
23448276 2013 Differential regulation of ?-glutamyltransferase and glutamate cysteine ligase expression after mitochondrial uncoupling: ?-glutamyltransferase is regulated in an Nrf2- and NF?B-independent manner.
23443115 2012 Identification of candidate polymorphisms on stress oxidative and DNA damage repair genes related with clinical outcome in breast cancer patients.
23255485 2013 Dietary flavonoid genistein induces Nrf2 and phase II detoxification gene expression via ERKs and PKC pathways and protects against oxidative stress in Caco-2 cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22824134 2012 Polymorphism in glutamate cysteine ligase catalytic subunit (GCLC) is associated with sulfamethoxazole-induced hypersensitivity in HIV/AIDS patients.
22610501 2013 A functional trinucleotide repeat polymorphism in the 5'-untranslated region of the glutathione biosynthetic gene GCLC is associated with increased risk for lung and aerodigestive tract cancers.
22452920 2012 Identifying microRNA/mRNA dysregulations in ovarian cancer.
22249522 2012 High expression of GCLC is associated with malignant melanoma of low oxidative phenotype and predicts a better prognosis.
21962117 2011 Association of genetic variants in the promoter region of genes encoding p22phox (CYBA) and glutamate cysteine ligase catalytic subunit (GCLC) and renal disease in patients with type 1 diabetes mellitus.
21871559 2011 Activation of promoter activity of the catalytic subunit of ?-glutamylcysteine ligase (GCL) in brain endothelial cells by insulin requires antioxidant response element 4 and altered glycemic status: implication for GCL expression and GSH synthesis.
21657237 2011 Enzymatic defects underlying hereditary glutamate cysteine ligase deficiency are mitigated by association of the catalytic and regulatory subunits.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21444626 2011 A GAG trinucleotide-repeat polymorphism in the gene for glutathione biosynthetic enzyme, GCLC, affects gene expression through translation.
21438662 2011 Association of polymorphisms in glutamate-cysteine ligase catalytic subunit and microsomal triglyceride transfer protein genes with nonalcoholic fatty liver disease.
21277635 2011 Glutamate cysteine ligase (GCL) and self reported depression: an association study from the HUNT.
21269460 2011 Initial characterization of the human central proteome.
21156206 2011 Interaction of GAG trinucleotide repeat and C-129T polymorphisms impairs expression of the glutamate-cysteine ligase catalytic subunit gene.
21105962 2011 No association between glutathione-synthesis-related genes and Japanese schizophrenia.
20970495 2011 Posttranslational modification and regulation of glutamate-cysteine ligase by the ?,?-unsaturated aldehyde 4-hydroxy-2-nonenal.
20732852 2010 Positive correlation between PPARgamma/PGC-1alpha and gamma-GCS in lungs of rats and patients with chronic obstructive pulmonary disease.
20712757 2010 Assessing oxidative pathway genes as risk factors for bipolar disorder.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20673128 2011 Genetic dysregulation of glutathione synthesis predicts alteration of plasma thiol redox status in schizophrenia.
20659789 2010 Common variants conferring risk of schizophrenia: a pathway analysis of GWAS data.
20655259 2010 An ethnic-specific polymorphism in the catalytic subunit of glutamate-cysteine ligase impairs the production of glutathione intermediates in vitro.
20615707 2010 Genetic polymorphisms of Chinese patients with ischemic stroke and concurrent stenoses of extracranial and intracranial vessels.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
20180881 2010 Human neuroblastoma cells with MYCN amplification are selectively resistant to oxidative stress by transcriptionally up-regulating glutamate cysteine ligase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19817962 2010 Association of polymorphisms of glutamate-cystein ligase and microsomal triglyceride transfer protein genes in non-alcoholic fatty liver disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19567187 2009 [Effects of erythromycin on the synthesis of interleukin-8 and gamma-glutamylcysteine synthetase induced by 4-hydroxynonenal in the bronchial epithelial cells].
19515364 2009 Genetic background of lead and mercury metabolism in a group of medical students in Austria.
19347979 2009 Evaluation of glutathione metabolic genes on outcomes in advanced non-small cell lung cancer patients after initial treatment with platinum-based chemotherapy: an NCCTG-97-24-51 based study.
19041695 2009 Skin fibroblast model to study an impaired glutathione synthesis: consequences of a genetic polymorphism on the proteome.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18926903 2008 Insulin stimulation of gamma-glutamylcysteine ligase catalytic subunit expression increases endothelial GSH during oxidative stress: influence of low glucose.
18614560 2008 Genetic variants of microsomal epoxide hydrolase and glutamate-cysteine ligase in COPD.
18560528 2008 Genetic variation in glutathione-related genes and body burden of methylmercury.
18549827 2008 Functional significance of the GAG trinucleotide-repeat polymorphism in the gene for the catalytic subunit of gamma-glutamylcysteine ligase.
18420959 2008 Lung function loss, smoking, vitamin C intake, and polymorphisms of the glutamate-cysteine ligase genes.
18276794 2008 SHP-1 inhibition by 4-hydroxynonenal activates Jun N-terminal kinase and glutamate cysteine ligase.
18066575 2008 Influence of glutathione-related genes on symptoms and immunologic markers among vulcanization workers in the southern Sweden rubber industries.
18035085 2007 Glutamate-cysteine ligase polymorphism, hypertension, and male sex are associated with cardiovascular events. Biochemical and genetic characterization of Italian subpopulation.
17961430 2007 [The glutamate-cysteine ligase catalytic subunit gene C-129T and modifier subunit gene G-23T polymorphisms and risk for coronary diseases].
17921251 2007 Impaired glutathione synthesis in schizophrenia: convergent genetic and functional evidence.
17643973 2007 The relationship between polymorphisms in the glutamate cysteine ligase gene and asthma susceptibility.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17479437 2007 Glutamate cysteine ligase catalytic subunit promoter polymorphisms and associations with type 1 diabetes age-at-onset and GAD65 autoantibody levels.
17344309 2007 Upregulation of gamma-glutamate-cysteine ligase as part of the long-term adaptation process to iron accumulation in neuronal SH-SY5Y cells.
17333241 2007 Levels of 2-thiothiazolidine-4-carboxylic acid (TTCA) and effect modification of polymorphisms of glutathione-related genes in vulcanization workers in the southern Sweden rubber industries.
17207022 2007 Genetic analysis of CC16, OGG1 and GCLC polymorphisms and susceptibility to COPD.
17109620 2006 NRF2-dependent glutamate-L-cysteine ligase catalytic subunit expression mediates insulin protection against hyperglycemia- induced brain endothelial cell apoptosis.
16766924 2006 Chronic beryllium disease and glutathione biosynthesis genes.
16690975 2006 Variants in the glutamate-cysteine-ligase gene are associated with cystic fibrosis lung disease.
16599007 2004 Polymorphisms in glutathione-related genes affect methylmercury retention.
16491484 2006 Enhanced gamma-glutamylcysteine synthetase activity decreases drug-induced oxidative stress levels and cytotoxicity.
16403949 2006 Regulation of heavy subunit chain of gamma-glutamylcysteine synthetase by tumor necrosis factor-alpha in lens epithelial cells: role of LEDGF/p75.
16322067 2006 Adrenomedullin regulates cellular glutathione content via modulation of gamma-glutamate-cysteine ligase catalytic subunit expression.
16183645 2005 Knockdown of glutamate-cysteine ligase by small hairpin RNA reveals that both catalytic and modulatory subunits are essential for the survival of primary neurons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485876 2004 Adenoviral overexpression of the glutamylcysteine ligase catalytic subunit protects pancreatic islets against oxidative stress.
15451055 2004 Human glutamate cysteine ligase gene regulation through the electrophile response element.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676828 2004 Transcriptional regulation by the estrogen receptor of antioxidative stress enzymes and its functional implications.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12663448 2003 A novel missense mutation in the gamma-glutamylcysteine synthetase catalytic subunit gene causes both decreased enzymatic activity and glutathione production.
12598062 2003 Association of polymorphism in glutamate-cysteine ligase catalytic subunit gene with coronary vasomotor dysfunction and myocardial infarction.
12500194 2003 Cytochrome P450 2E1 responsiveness in the promoter of glutamate-cysteine ligase catalytic subunit.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070177 2002 Identification of a variant antioxidant response element in the promoter of the human glutamate-cysteine ligase modifier subunit gene. Revision of the ARE consensus sequence.
11972604 2002 Oxidant stress induces gamma-glutamylcysteine synthetase and glutathione synthesis in human bronchial epithelial NCI-H292 cells.
11844594 2002 Genetic determinants of lung cancer short-term survival: the role of glutathione-related genes.
11820781 2002 Induction of multidrug resistance proteins MRP1 and MRP3 and gamma-glutamylcysteine synthetase gene expression by nonsteroidal anti-inflammatory drugs in human colon cancer cells.
10733484 2000 A missense mutation in the heavy subunit of gamma-glutamylcysteine synthetase gene causes hemolytic anemia.
10515893 1999 The molecular basis of a case of gamma-glutamylcysteine synthetase deficiency.
10439045 1999 Overexpression of gamma-glutamylcysteine synthetase suppresses tumor necrosis factor-induced apoptosis and activation of nuclear transcription factor-kappa B and activator protein-1.
10395918 1999 Regulation of gamma-glutamylcysteine synthetase regulatory subunit (GLCLR) gene expression: identification of the major transcriptional start site in HT29 cells.
9841880 1998 Identification of an important cysteine residue in human glutamate-cysteine ligase catalytic subunit by site-directed mutagenesis.
9675072 1998 Expression and purification of human gamma-glutamylcysteine synthetase.
8995480 1996 Genetic mapping of GLCLC, the human gene encoding the catalytic subunit of gamma-glutamyl-cysteine synthetase, to chromosome band 6p12 and characterization of a polymorphic trinucleotide repeat within its 5' untranslated region.
8825659 1995 Mapping of the glutamate-cysteine ligase catalytic subunit gene (GLCLC) to human chromosome 6p12 and mouse chromosome 9D-E and of the regulatory subunit gene (GLCLR) to human chromosome 1p21-p22 and mouse chromosome 3H1-3.
8104187 1993 gamma-Glutamylcysteine synthetase and active transport of glutathione S-conjugate are responsive to heat shock in K562 erythroid cells.
7789189 1995 Assignment of the gene (GLCLC) that encodes the heavy subunit of gamma-glutamylcysteine synthetase to human chromosome 6.
7726839 1995 Identification of a putative antioxidant response element in the 5'-flanking region of the human gamma-glutamylcysteine synthetase heavy subunit gene.
5058793 1972 -Glutamyl-cysteine synthetase deficiency. A cause of hereditary hemolytic anemia.
2294991 1990 Gamma-glutamylcysteine synthetase deficiency and hemolytic anemia.
1350904 1992 Cloning and nucleotide sequence of a full-length cDNA for human liver gamma-glutamylcysteine synthetase.
24639 1978 Inactivation of human gamma-glutamylcysteine synthetase by cystamine. Demonstration and quantification of enzyme-ligand complexes.