Property Summary

Ligand Count 1
NCBI Gene PubMed Count 101
PubMed Score 294.62
PubTator Score 453.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0
Disease Target Count Z-score Confidence
Toxic encephalopathy 141 3.269 1.6
Cancer 2499 3.216 1.6
Ancylostomiasis 6 3.175 1.6

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 4.5e-06
Chronic Lymphocytic Leukemia 1.338 2.0e-03
chronic rhinosinusitis -1.460 4.1e-02
Down syndrome 1.400 1.1e-03
glioblastoma -1.200 6.4e-03
interstitial cystitis -1.200 9.7e-03
lung adenocarcinoma 1.200 9.5e-05
lung cancer 2.700 8.1e-04
lung carcinoma 1.300 3.1e-11
non-small cell lung cancer 1.859 2.4e-12
osteosarcoma -1.308 3.1e-03
ovarian cancer -1.200 6.4e-03
pancreatic ductal adenocarcinoma liver m... -1.301 3.0e-02
pituitary cancer 1.800 1.8e-06
psoriasis 1.100 1.6e-02
urothelial carcinoma -1.100 4.7e-02

Protein-protein Interaction (2)

Gene RIF (88)

AA Sequence

MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLS      1 - 70
GEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQA     71 - 140
LCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRFSTLTRNIRHRRGEKVVINVPIFKD    141 - 210
KNTPSPFIETFTEDDEASRASKPDHIYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALS    211 - 280
AASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTI    281 - 350
DKEIYEQLLQEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI    351 - 420
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDI    421 - 490
CKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNSYLENMEVDVDTRCSILNYLK    491 - 560
LIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSG    561 - 630
SKTDSSN                                                                   631 - 637
//

Text Mined References (105)

PMID Year Title