Property Summary

NCBI Gene PubMed Count 179
PubMed Score 128.05
PubTator Score 149.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (142)

PMID Text
27455017 The AA genotype of the GCKR rs780094 polymorphism may increase the risk of T2D among ethnic Uygurs from Xinjiang.
27015186 We found that the PPARGC1A and PNPLA3 variants, but not the GCKR variant, were associated with NASH.
26620281 Given that acetylated GKRP may affiliate with type-2 diabetes mellitus (T2DM), understanding the mechanism of GKRP acetylation in the liver could reveal novel targets within the GK-GKRP pathway, for treating T2DM and other metabolic pathologies.
26578543 Lifestyle Intervention for Weight Loss and Cardiometabolic Changes in the Setting of Glucokinase Regulatory Protein Inhibition: Glucokinase Regulatory Protein-Leu446Pro Variant in Look AHEAD
26515422 The GCKR rs780092 variant showed opposite-directional associations with type 2 diabetes and hypertriacylglycerolaemia in a Chinese population.
26432016 Disruption of the GKRP-glucokinase complex is a promising new antidiabetic target, since it results in lower plasma glucose levels without inducing hypoglycemia[review]
26291577 interaction effects between GCKR genetic variants and the dietary MUFA:SFA ratio on lipid levels
26290326 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males.
26261636 SNPs in SORT1, CETP and GCKR were individually associated with lipid level variations in Algerian population.
26174136 rs1260326 in GCKR significantly associates with alpha-1 antitrypsin levels.
26136510 this is the first evidence that n-3 LC-PUFAs may modulate the impact of the GCKR rs1260326 polymorphism on TG concentrations in adolescents. Several molecular mechanisms, in link with glucose uptake, could explain these findings
26115082 GCKR polymorphisms might be independent predictors of survival in metastatic gastric cancer patients treated with first-line EOF chemotherapy
26043229 GCKR rs1260326 gene variant, which is associated with greater glycolysis, increases hepatic De Novo Lipogenesis.
25920552 Two new polymorphisms associated with gall bladder disease and obesity in women have been identified, GCKR rs1260326, and TTC39B rs686030.
25692341 GCKR variants across the allelic spectrum have effects on glucose and lipid homeostasis. [Review]
25369983 The AA genotype in maternal GCKR rs780094 is associated with an increased risk for neural tube defects and spina bifida in the Chinese population.
25288136 Single-nucleotide polymorphisms alleles near GCKR that were associated with higher coffee consumption.
25283508 GCKR rs780094 variants modulate uric acid concentrations in Chinese males.
25167786 meta-analysis provides evidence of significant association between GCKR rs780094 and risk of nonalcoholic fatty liver disease
24918535 Individuals who are homozygous TT at rs1260326 of the GCKR gene have higher triglyceride, total and LDL cholesterol levels regardless of the presence of GCK mutations.
24879641 Despite evidence for their collective functional and clinical relevance, results emphasize the low predictive value of rare GCKR variants in individuals and the complex heritability of lipid traits.
24804806 genetic association studies in population in Norfolk, England: Data suggest that an SNP in GCKR (rs780094) is associated with risk of cardiometabolic diseases (cardiovascular diseases; diabetes type 2) in the population studied.
24785259 genetic association studies in Japan: Data suggest that SNPs in GCKR (rs780094), TRIB1 (tribbles pseudokinase 1, rs2954021), and PNPLA3 (patatin-like phospholipase domain containing 3, rs738409) are associated with nonalcoholic fatty liver disease.
24568320 Data suggest that GK (glucokinase) and GKRP (glucokinase regulatory protein) form stabile complex with co-operative interaction and allosteric regulation of both activities; studies involved isolated recombinant proteins/site-directed mutagenesis.
24535998 Results showed that the GCKR rs1260326 polymorphism is significantly associated with the risk of chronic kidney disease (CKD) in Japanese individuals, and found a possible significant interaction between this polymorphism and current smoking on CKD risk.
24498332 Data indicate that in non-alcoholic fatty liver disease (NAFLD), glucokinase regulatory protein (GCKR) rs780094 C>T is associated with the severity of liver fibrosis and with higher serum triglyceride levels.
24477042 genetic association studies in Han Chinese population in Taiwan: Data suggest that an SNP in GCKR (rs780094) is associated with increased susceptibility/risk of nonalcoholic fatty liver disease in the population of obese children studied.
24385677 The GCKR rs780093 polymorphism is a risk factor for coronary heart disease in individuals aged 65 and older.
24178511 genetic polymorphism is associated with Factor VII and with plasma viscosity
24146201 GK and GKRP immunoreactivities are changed in pyramidal neurons and newly expressed in astrocytes in the ischemic CA1 after transient cerebral ischemia
23989113 GCKR rs780094 was associated with TG, HDL-C, and HbA1c levels, as well as with CIMT in Japanese community-dwelling men.
23957911 Our observations provide a model for the regulation of GCK-GKRP complex stability by sugar phosphates involving a subtle reorganization of the GKRP scaffold.
23894584 Findings from middle-aged to older adults confirm associations between rs1260326 GCKR and triglycerides and glucose, suggest gene-environment interactions, but do not provide evidence that its relevance extends to cognitive and physical capability.
23840762 GCKR rs780094 variant confers high cross-ethnicity risk for the development of T2DM, while significant associations between GCK, MTNR1B and G6PC2 variants and T2DM risk are limited to Caucasians.
23800943 GCKR and PNPLA3 genes interact to result in increased susceptibility to NAFLD.
23733961 We find that GKRP acts as an allosteric switch for GK in blood glucose control by the liver.
23621087 Crystal structure of glucokinase regulatory protein
23586973 RESULTS: rs1260326 in GCKR (beta=1.30, P = 3.23E-03), rs17319721 in SHROOM3 (beta = -1.28, P-value = 3.18E-03) and rs12917707 in UMOD (beta = 2.0, P-value = 8.84E-04) were significantly associated with baseline estimated GFR
23416328 Some, but not all, associations between variants in NCAN, lysophospholipase-like 1, GCKR, and PPP1R3B with hepatic steatosis (with and without increased ALT level) were significant within subpopulations.
23383164 Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in Chinese children.
23307301 This meta-analysis suggests that the rs780094 polymorphism in GCKR is associated with elevated type 2 diabetes risk.
22956255 no detectable effect (with an OR >2.1) of the variants in GCKR, GIPR, ADCY5 and VPS13C on the response to sulfonylurea treatment, indicating that these variants are not significantly contributing to the risk of SH in patients with T2D
22716779 genetic association study in population in Spain: Data suggest that one SNP in GCKR (rs1260326; not rs1799884) is significantly associated with hypertriglyceridemia; risk of cardiovascular disease can be modulated by adherence to Mediterranean diet.
22553379 Only one single nucleotide polymorphism of GCKR hyperglycemia was significantly associated with amino acid blood levels, hyperglycemia, and risk for type 2 diabetes.
22517333 Essential roles of the polymorphisms of the APOA5, GCK and GCKR in the lipid or glucose metabolism disorders.
22395765 2 SNPs, rs780093 and rs780094, located in intronic regions of the GCKR gene were found to be significantly associated with the development of gout in male Han Chinese; GCKR was identified as a novel candidate gene associated with gout
22182842 Defects were observed for the majority of rare variants after assessment of cellular localization, ability to interact with GCK, and kinetic activity of the encoded proteins. Functional rare variants showed associations with lipid phenotypes.
22105854 The rs1260326 in GCKR is associated with hepatic fat accumulation along with large VLDL and triglyceride levels. GCKR and PNPLA3 act together to convey susceptibility to fatty liver in obese youths.
22038520 Data suggest that GCKR P446L variant (an SNP [rs1260326] associated with type 2 diabetes risk) alters ability of GCKR to sequester glucokinase in nucleus of hepatocytes.
22015968 Study provides evidence that GCKR rs780094, a single-nucleotide polymorphism related to diabetes, may be associated with pancreatic cancer risk.
21789219 The role of four loci (ADCY5, GIPR, GCKR and VPS13C) in early impairment of glucose and insulin metabolism in children, was investigated.
21674002 a significant interaction between the GCKR rs1260326-P446L polymorphism and plasma n-3 PUFA levels modulating insulin resistance and inflammatory markers in metabolic syndrome
21643755 Evidence for the existence of rare APOA5 and GCKR haplotypes in metabolic syndrome patients with higher triglyceride levels, which contribute to the complex lipid metabolism alteration in this disease.
21569451 The rs3817588 A/G polymorphism of the glucokinase regulatory protein gene was associated with type 2 diabetes and plasma triglyceride level in the Han Chinese population.
21511510 Our findings confirm the inverse modulating effect of functional GCKR variants on triglycerides and glucose levels in obese paediatric patients and healthy normal-weight controls.
21454522 pharmacological manipulation of GCK activity at locations distal from the allosteric activator site is possible.
21411509 Findings are compatible with the idea that GCKR variability may play a pathogenetic role in both type 2 diabetes and CKD.
21318467 Data show that a novel polymorphism (rs4425043) in the GCKR gene increases the risk of overweight and obesity in Chinese women.
21236713 glucokinase regulator is a susceptibility gene in Japanese families with clustered diabetes
21114848 GCKR gene variants inversely associated with serum triglycerides/fasting plasma glucose levels in type 2 diabetes and metabolic syndrome. Suggest cardiovascular risk role of GCKR minor allele carriage based on carotid intima-media thickness association.
21072187 Observational study of gene-disease association. (HuGE Navigator)
21071687 GCKR genotypes had effect on triglycerides, remnant cholesterol, and apolipoprotein B levels.
21071687 Observational study of gene-disease association. (HuGE Navigator)
21054877 Observational study of gene-disease association. (HuGE Navigator)
21036910 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20802025 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20693352 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20668700 Study showed that SNPs from GCK, G6PC2 and MTNR1B modulated the fasting glucose levels in the normoglycaemic population while SNPs from G6PC2 and GCKR was associated with type 2 diabetes.
20668700 Observational study of gene-disease association. (HuGE Navigator)
20661421 Findings indicate rs780094 in GCKR has independent associations with multiple metabolic traits as well as incident diabetes, but not incident CHD or stroke.
20661421 Observational study of gene-disease association. (HuGE Navigator)
20657596 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628598 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625834 the GCKR genotype is associated with non-alcoholic fatty liver disease in Chinese people
20625834 Observational study of gene-disease association. (HuGE Navigator)
20574426 the GCKR rs780094 polymorphism is associated with susceptibility of type 2 diabetes, reduced fasting plasma glucose levels, increased triglycerides levels and lower HOMA-IR in Japanese population
20574426 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20570916 Observational study of gene-disease association. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20352598 GCKR polymorphisms increase plasma levels of triglycerides and free fatty acids, but do not elevate cardiovascular risk.
20352598 Observational study of gene-disease association. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20167577 Observational study of gene-disease association. (HuGE Navigator)
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20081857 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19937311 Fasting glucose association at GCKR is replicable across ethnic groups, although ethnic diversity in the pattern and strength of linkage disequilibrium exists.
19937311 Observational study of gene-disease association. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)
19847674 Results describe the association of the functional variants of glucokinase regulatory protein and apolipoprotein A5 genes with non-fasting triglyceride levels and their susceptibility nature in ischemic stroke.
19847674 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19656773 Data show that SNPs associated with TG in normolipidemic samples, including APOA5, TRIB1, TBL2, GCKR, GALNT2 and ANGPTL3 were significantly associated with HLP types 2B, 3, 4 and 5.
19656773 Observational study of gene-disease association. (HuGE Navigator)
19651812 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19643913 Data show that assays matched for GKRP activity demonstrated no difference in dose-dependent inhibition of GCK activity or F1P-mediated regulation.
19533084 Variations and single-nucleotide polymorphisms are nott associated in variations in fasting plasma glucose and an increased risk of type 2 diabetes.
19533084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19526250 Glucokinase regulatory protein gene polymorphism is associated with postprandial triglyceridemia.
19526250 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
19247372 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19241058 GCKR polymorphism contributes to the risk of type 2 diabetes and dyslipidaemia in Han Chinese individuals.
19241058 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19148283 Observational study of gene-disease association. (HuGE Navigator)
19073768 This protein and glucokinase increase fasting blood glucose and risk of diabetics who have other risk factors.
19073768 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
19056598 SNPs in GCKR and APOA5 have an additive effect on both fasting and postprandial triacylglycerol and contribute to the interindividual variability in response to fenofibrate treatment.
19056598 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18678614 Data show that common missense variant in the glucokinase regulatory protein gene is associated with increased plasma triglyceride and C-reactive protein but lower fasting glucose concentrations.
18678614 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18596051 Observational study of gene-disease association. (HuGE Navigator)
18556336 Data show thatP446L polymorphism carriers are protected against type 2 diabetes despite higher triglyceride levels and risk of dyslipidemia.
18556336 Observational study of gene-disease association. (HuGE Navigator)
18439548 Observational study of gene-disease association. (HuGE Navigator)
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18008060 GCKR rs780094 polymorphism may increase glucokinase regulatory protein activity to induce improved glycaemic regulation at the expense of hypertriacylglycerolaemia
18008060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17828387 Deletions are detected in exons are investigated in maturity-onset diabetes of the young.
17186219 Different type 2 doabetes mutations impair glucokinase function through different mechanisms such as enzymatic activity, protein stability and increased interaction with the flucokinase receptor
17082186 The alteration in glucokinase (GK) activity caused by polymorphic activating mutations may have a more profound biological impact than the alleviation of inhibition caused by interaction with GKRP.
16401311 Observational study of gene-disease association. (HuGE Navigator)
14627435 The inhibition of glucokinase by rat and human GKRP are compared.
12739015 Observational study of gene-disease association. (HuGE Navigator)
12739015 Mutations in GKRP are found in the French population, but they do not account for the linkage between the 2p23 locus and quantitative markers of obesity.

AA Sequence

MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALST      1 - 70
YQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAG     71 - 140
GDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNP    141 - 210
VSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKT    211 - 280
VDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECI    281 - 350
HTFGADFRDVRGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ    351 - 420
TIVEQVKEKTNHIQALAHSTVGQTLPIPLKKLFPSIISITWPLLFFEYEGNFIQKFQRELSTKWVLNTVS    421 - 490
TGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLRAIHFPQPLSDDIRAAPISCH    491 - 560
VQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEILEPDVQ         561 - 625
//

Text Mined References (182)

PMID Year Title
27455017 2016 [Association of GCKR gene polymorphisms and type 2 diabetes among ethnic Uygurs].
27015186 2016 Interactions of a PPARGC1A Variant and a PNPLA3 Variant Affect Nonalcoholic Steatohepatitis in Severely Obese Taiwanese Patients.
26620281 2015 Acetylation of glucokinase regulatory protein decreases glucose metabolism by suppressing glucokinase activity.
26578543 2016 Lifestyle Intervention for Weight Loss and Cardiometabolic Changes in the Setting of Glucokinase Regulatory Protein Inhibition: Glucokinase Regulatory Protein-Leu446Pro Variant in Look AHEAD.
26515422 2016 Discrete associations of the GCKR variant with metabolic risk in a Chinese population: longitudinal change analysis.
26432016 2015 Modulation of Glucokinase Regulatory Protein: A Double-Edged Sword?
26291577 2015 The dietary monounsaturated to saturated fatty acid ratio modulates the genetic effects of GCKR on serum lipid levels in children.
26290326 2015 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males: a case-control study.
26261636 2015 Associations of common SNPs in the SORT1, GCKR, LPL, APOA1, CETP, LDLR, APOE genes with lipid trait levels in an Algerian population sample.
26174136 2015 Three missense variants of metabolic syndrome-related genes are associated with alpha-1 antitrypsin levels.
26136510 2015 The n-3 long-chain PUFAs modulate the impact of the GCKR Pro446Leu polymorphism on triglycerides in adolescents.
26115082 2015 Effects of IGF2BP2, KCNQ1 and GCKR polymorphisms on clinical outcome in metastatic gastric cancer treated with EOF regimen.
26043229 2015 Hepatic De Novo Lipogenesis in Obese Youth Is Modulated by a Common Variant in the GCKR Gene.
25920552 2016 Lipids, obesity and gallbladder disease in women: insights from genetic studies using the cardiovascular gene-centric 50K SNP array.
25692341 2015 Glucokinase regulatory protein: complexity at the crossroads of triglyceride and glucose metabolism.
25369983 2015 Association between maternal single nucleotide polymorphisms in genes regulating glucose metabolism and risk for neural tube defects in offspring.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25283508 2014 Serum uric acid levels are associated with polymorphisms in the SLC2A9, SF1, and GCKR genes in a Chinese population.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25167786 2015 Common variant in the glucokinase regulatory gene rs780094 and risk of nonalcoholic fatty liver disease: a meta-analysis.
24918535 2014 Genetic variability of GCKR alters lipid profiles in children with monogenic and autoimmune diabetes.
24879641 2014 Inheritance of rare functional GCKR variants and their contribution to triglyceride levels in families.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24804806 2014 The association between Mediterranean Diet Score and glucokinase regulatory protein gene variation on the markers of cardiometabolic risk: an analysis in the European Prospective Investigation into Cancer (EPIC)-Norfolk study.
24785259 2014 Association of polymorphisms in GCKR and TRIB1 with nonalcoholic fatty liver disease and metabolic syndrome traits.
24568320 2014 Analysis of the co-operative interaction between the allosterically regulated proteins GK and GKRP using tryptophan fluorescence.
24535998 2014 GCK, GCKR polymorphisms and risk of chronic kidney disease in Japanese individuals: data from the J-MICC Study.
24498332 2014 Glucokinase regulatory protein gene polymorphism affects liver fibrosis in non-alcoholic fatty liver disease.
24477042 2014 Genetic variants in GCKR and PNPLA3 confer susceptibility to nonalcoholic fatty liver disease in obese individuals.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24385677 2013 Positive association between GCKR rs780093 polymorphism and coronary heart disease in the aged Han Chinese.
24178511 2013 Gene-centric association signals for haemostasis and thrombosis traits identified with the HumanCVD BeadChip.
24146201 2013 Time-course changes in immunoreactivities of glucokinase and glucokinase regulatory protein in the gerbil hippocampus following transient cerebral ischemia.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
24023260 2013 Genetic association with lipids in Filipinos: waist circumference modifies an APOA5 effect on triglyceride levels.
23989113 2014 Association of the GCKR rs780094 polymorphism with metabolic traits including carotid intima-media thickness in Japanese community-dwelling men, but not in women.
23957911 2013 Structural basis for regulation of human glucokinase by glucokinase regulatory protein.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23894584 2013 Associations between a polymorphism in the pleiotropic GCKR and Age-related phenotypes: the HALCyon programme.
23840762 2013 Large scale meta-analyses of fasting plasma glucose raising variants in GCK, GCKR, MTNR1B and G6PC2 and their impacts on type 2 diabetes mellitus risk.
23800943 2014 Association of glucokinase regulatory gene polymorphisms with risk and severity of non-alcoholic fatty liver disease: an interaction study with adiponutrin gene.
23733961 2013 Molecular basis for the role of glucokinase regulatory protein as the allosteric switch for glucokinase.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23621087 2013 Crystal structure of glucokinase regulatory protein.
23586973 2013 Investigation of known estimated glomerular filtration rate loci in patients with type 2 diabetes.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23416328 2013 Association between variants in or near PNPLA3, GCKR, and PPP1R3B with ultrasound-defined steatosis based on data from the third National Health and Nutrition Examination Survey.
23383164 2013 GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23307301 2013 Association of glucokinase regulatory protein polymorphism with type 2 diabetes and fasting plasma glucose: a meta-analysis.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22956255 2013 Genetic variants in GCKR, GIPR, ADCY5 and VPS13C and the risk of severe sulfonylurea-induced hypoglycaemia in patients with type 2 diabetes.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22716779 2013 Relevant associations of the glucokinase regulatory protein/glucokinase gene variation with TAG concentrations in a high-cardiovascular risk population: modulation by the Mediterranean diet.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22558069 2012 Association of common variants in TNFRSF13B, TNFSF13, and ANXA3 with serum levels of non-albumin protein and immunoglobulin isotypes in Japanese.
22553379 2012 Hyperglycemia and a common variant of GCKR are associated with the levels of eight amino acids in 9,369 Finnish men.
22517333 2012 Associations of apolipoprotein A5 (APOA5), glucokinase (GCK) and glucokinase regulatory protein (GCKR) polymorphisms and lifestyle factors with the risk of dyslipidemia and dysglycemia in Japanese - a cross-sectional data from the J-MICC Study.
22508271 2012 Fasting glucose GWAS candidate region analysis across ethnic groups in the Multiethnic Study of Atherosclerosis (MESA).
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22395765 2012 Association between gout and polymorphisms in GCKR in male Han Chinese.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22182842 2012 Correlation of rare coding variants in the gene encoding human glucokinase regulatory protein with phenotypic, cellular, and kinetic outcomes.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22105854 2012 Variant in the glucokinase regulatory protein (GCKR) gene is associated with fatty liver in obese children and adolescents.
22038520 2012 Cellular characterisation of the GCKR P446L variant associated with type 2 diabetes risk.
22015968 2012 Genes related to diabetes may be associated with pancreatic cancer in a population-based case-control study in Minnesota.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21789219 2011 Effects of genetic variants in ADCY5, GIPR, GCKR and VPS13C on early impairment of glucose and insulin metabolism in children.
21674002 2011 Glucokinase regulatory protein genetic variant interacts with omega-3 PUFA to influence insulin resistance and inflammation in metabolic syndrome.
21643755 2012 Common functional variants of APOA5 and GCKR accumulate gradually in association with triglyceride increase in metabolic syndrome patients.
21569451 2011 Associations of common polymorphisms in GCKR with type 2 diabetes and related traits in a Han Chinese population: a case-control study.
21511510 2011 Functional glucokinase regulator gene variants have inverse effects on triglyceride and glucose levels, and decrease the risk of obesity in children.
21454522 2011 Discovery of a novel site regulating glucokinase activity following characterization of a new mutation causing hyperinsulinemic hypoglycemia in humans.
21411509 2011 Variants of GCKR affect both ?-cell and kidney function in patients with newly diagnosed type 2 diabetes: the Verona newly diagnosed type 2 diabetes study 2.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21318467 2011 Glucokinase regulatory protein (GCKR) gene rs4425043 polymorphism is associated with overweight and obesity in Chinese women.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21236713 2011 GCKR mutations in Japanese families with clustered type 2 diabetes.
21114848 2010 GCKR gene functional variants in type 2 diabetes and metabolic syndrome: do the rare variants associate with increased carotid intima-media thickness?
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
21071687 2011 TRIB1 and GCKR polymorphisms, lipid levels, and risk of ischemic heart disease in the general population.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
21036910 2011 Association of a fasting glucose genetic risk score with subclinical atherosclerosis: The Atherosclerosis Risk in Communities (ARIC) study.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20802025 2010 Genome-wide association study identifies novel loci for plasma levels of protein C: the ARIC study.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20693352 2010 Interactions of dietary whole-grain intake with fasting glucose- and insulin-related genetic loci in individuals of European descent: a meta-analysis of 14 cohort studies.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20668700 2010 Effects of GCK, GCKR, G6PC2 and MTNR1B variants on glucose metabolism and insulin secretion.
20661421 2010 Association of rs780094 in GCKR with metabolic traits and incident diabetes and cardiovascular disease: the ARIC Study.
20657596 2010 Excess of rare variants in genes identified by genome-wide association study of hypertriglyceridemia.
20628598 2010 Common polymorphisms in MTNR1B, G6PC2 and GCK are associated with increased fasting plasma glucose and impaired beta-cell function in Chinese subjects.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625834 2011 Genetic variation in the GCKR gene is associated with non-alcoholic fatty liver disease in Chinese people.
20574426 2010 The GCKR rs780094 polymorphism is associated with susceptibility of type 2 diabetes, reduced fasting plasma glucose levels, increased triglycerides levels and lower HOMA-IR in Japanese population.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20570916 2010 Fine-mapping in African Americans of 8 recently discovered genetic loci for plasma lipids: the Jackson Heart Study.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20352598 2010 Glucokinase-activating GCKR polymorphisms increase plasma levels of triglycerides and free fatty acids, but do not elevate cardiovascular risk in the Ludwigshafen Risk and Cardiovascular Health Study.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20162742 2010 Predictive value of 8 genetic loci for serum uric acid concentration.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20081857 2010 Genetic variation in GIPR influences the glucose and insulin responses to an oral glucose challenge.
19937311 2010 Common variants at the GCK, GCKR, G6PC2-ABCB11 and MTNR1B loci are associated with fasting glucose in two Asian populations.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19861489 2010 Replication of the five novel loci for uric acid concentrations and potential mediating mechanisms.
19847674 2010 Functional variants of glucokinase regulatory protein and apolipoprotein A5 genes in ischemic stroke.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19651812 2009 Common genetic variation near melatonin receptor MTNR1B contributes to raised plasma glucose and increased risk of type 2 diabetes among Indian Asians and European Caucasians.
19643913 2009 The P446L variant in GCKR associated with fasting plasma glucose and triglyceride levels exerts its effect through increased glucokinase activity in liver.
19533084 2009 Combined effects of single-nucleotide polymorphisms in GCK, GCKR, G6PC2 and MTNR1B on fasting plasma glucose and type 2 diabetes risk.
19526250 2009 Glucokinase regulatory protein gene polymorphism affects postprandial lipemic response in a dietary intervention study.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19247372 2009 Construction of a prediction model for type 2 diabetes mellitus in the Japanese population based on 11 genes with strong evidence of the association.
19241058 2009 Association of GCKR rs780094, alone or in combination with GCK rs1799884, with type 2 diabetes and related traits in a Han Chinese population.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19073768 2009 Interaction effect of genetic polymorphisms in glucokinase (GCK) and glucokinase regulatory protein (GCKR) on metabolic traits in healthy Chinese adults and adolescents.
19068216 2009 Investigation of Crohn's disease risk loci in ulcerative colitis further defines their molecular relationship.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19056598 2009 Association between glucokinase regulatory protein (GCKR) and apolipoprotein A5 (APOA5) gene polymorphisms and triacylglycerol concentrations in fasting, postprandial, and fenofibrate-treated states.
18678614 2008 Common missense variant in the glucokinase regulatory protein gene is associated with increased plasma triglyceride and C-reactive protein but lower fasting glucose concentrations.
18596051 2008 Polygenic determinants of severe hypertriglyceridemia.
18556336 2008 The common P446L polymorphism in GCKR inversely modulates fasting glucose and triglyceride levels and reduces type 2 diabetes risk in the DESIR prospective general French population.
18454146 2008 Common genetic variation near MC4R is associated with waist circumference and insulin resistance.
18439548 2008 Loci related to metabolic-syndrome pathways including LEPR,HNF1A, IL6R, and GCKR associate with plasma C-reactive protein: the Women's Genome Health Study.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18179892 2008 Genome-wide association study identifies genes for biomarkers of cardiovascular disease: serum urate and dyslipidemia.
18008060 2008 The GCKR rs780094 polymorphism is associated with elevated fasting serum triacylglycerol, reduced fasting and OGTT-related insulinaemia, and reduced risk of type 2 diabetes.
17828387 2007 Partial and whole gene deletion mutations of the GCK and HNF1A genes in maturity-onset diabetes of the young.
17186219 2007 Functional analysis of human glucokinase gene mutations causing MODY2: exploring the regulatory mechanisms of glucokinase activity.
17082186 2006 Biochemical basis of glucokinase activation and the regulation by glucokinase regulatory protein in naturally occurring mutations.
16401311 2005 Novel polymorphisms in the GCKR gene and their influence on glucose and insulin levels in a Danish twin population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627435 2004 Differences in regulatory properties between human and rat glucokinase regulatory protein.
12739015 2003 Mutations in the glucokinase regulatory protein gene in 2p23 in obese French caucasians.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756407 2002 Identification of fructose 6-phosphate- and fructose 1-phosphate-binding residues in the regulatory protein of glucokinase.
11522786 2001 Characterization of glucokinase-binding protein epitopes by a phage-displayed peptide library. Identification of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase as a novel interaction partner.
11473043 2001 Treatment of type 2 diabetes by adenoviral-mediated overexpression of the glucokinase regulatory protein.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10588736 1999 Mice mutant for glucokinase regulatory protein exhibit decreased liver glucokinase: a sequestration mechanism in metabolic regulation.
10456334 1999 Glucokinase regulatory protein is essential for the proper subcellular localisation of liver glucokinase.
9570959 1998 Organization of the human glucokinase regulator gene GCKR.
9000692 1997 Glucokinase regulatory protein may interact with glucokinase in the hepatocyte nucleus.
8662230 1996 Co-localization of the ketohexokinase and glucokinase regulator genes to a 500-kb region of chromosome 2p23.
8626423 1996 Amino acid conservation in animal glucokinases. Identification of residues implicated in the interaction with the regulatory protein.
8589523 1995 Human glucokinase regulatory protein (GCKR): cDNA and genomic cloning, complete primary structure, and chromosomal localization.
7508874 1994 Search for a third susceptibility gene for maturity-onset diabetes of the young. Studies with eleven candidate genes.