Property Summary

NCBI Gene PubMed Count 26
PubMed Score 11.67
PubTator Score 16.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.100 6.0e-07
astrocytoma -1.100 3.4e-02
glioblastoma -1.700 6.9e-08
atypical teratoid / rhabdoid tumor -1.400 2.7e-05
medulloblastoma -1.200 1.3e-04
medulloblastoma, large-cell -1.900 4.8e-04
adult high grade glioma -1.300 2.4e-03
pilocytic astrocytoma -1.100 2.2e-04
ovarian cancer -1.400 5.1e-05
pituitary cancer -1.100 1.7e-03

Gene RIF (10)

PMID Text
26653856 These unexpected features support a model in which GCC185 collapses onto the Golgi surface, perhaps by binding to Rab GTPases, to mediate vesicle tethering.
22159419 Deletion of the ARL4A-interacting region of GCC185 results in inability to maintain Golgi structure and modulate endosome-to-Golgi transport.
21875948 Two distinct domains of GCC185 are needed either for Golgi structure maintenance or transport vesicle tethering. The domain needed for vesicle tethering binds to the clathrin adaptor AP-1.
19703403 Study demonstrates that Golgi recruitment of endogenous GCC185 does not involve Rab6A/A' and Arl1.
18946081 Results show that GCC185 contains at least six binding sites for as many as 14 different Rab GTPases across its entire length.
18243103 Rab and Arl GTPase family members cooperate in the localization of GCC2.
17488291 GCC2 is required for endosome-to-Golgi transport and maintenance of Golgi structure.
16885419 These data assign a specific pathway to an interesting, TGN-localized protein and suggest that GCC185 may participate in the docking of late endosome-derived, Rab9-bearing transport vesicles at the TGN.
15654769 The ability of the four mammalian GRIP domain proteins, p230, golgin-97, GCC88, and GCC185 to interact is reported.
12446665 targeting to subcompartments of trans-Golgi network by GRIP domain

AA Sequence

MEDLVQDGVASPATPGTGKSKLETLPKEDLIKFAKKQMMLIQKAKSRCTELEKEIEELRSKPVTEGTGDI      1 - 70
IKALTERLDALLLEKAETEQQCLSLKKENIKMKQEVEDSVTKMGDAHKELEQSHINYVKEIENLKNELMA     71 - 140
VRSKYSEDKANLQKQLEEAMNTQLELSEQLKFQNNSEDNVKKLQEEIEKIRPGFEEQILYLQKQLDATTD    141 - 210
EKKETVTQLQNIIEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENL    211 - 280
VKQCEASEKNIQKKYECELENLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLKELESQHSI    281 - 350
LKDEVTYMNNLKLKLEMDAQHIKDEFFHEREDLEFKINELLLAKEEQGCVIEKLKSELAGLNKQFCYTVE    351 - 420
QHNREVQSLKEQHQKEISELNETFLSDSEKEKLTLMFEIQGLKEQCENLQQEKQEAILNYESLREIMEIL    421 - 490
QTELGESAGKISQEFESMKQQQASDVHELQQKLRTAFTEKDALLETVNRLQGENEKLLSQQELVPELENT    491 - 560
IKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKK    561 - 630
VEQTIQYNSELEQKVNELTGGLEETLKEKDQNDQKLEKLMVQMKVLSEDKEVLSAEVKSLYEENNKLSSE    631 - 700
KKQLSRDLEVFLSQKEDVILKEHITQLEKKLQLMVEEQDNLNKLLENEQVQKLFVKTQLYGFLKEMGSEV    701 - 770
SEDSEEKDVVNVLQAVGESLAKINEEKCNLAFQRDEKVLELEKEIKCLQEESVVQCEELKSLLRDYEQEK    771 - 840
VLLRKELEEIQSEKEALQSDLLEMKNANEKTRLENQNLLIQVEEVSQTCSKSEIHNEKEKCFIKEHENLK    841 - 910
PLLEQKELRDRRAELILLKDSLAKSPSVKNDPLSSVKELEEKIENLEKECKEKEEKINKIKLVAVKAKKE    911 - 980
LDSSRKETQTVKEELESLRSEKDQLSASMRDLIQGAESYKNLLLEYEKQSEQLDVEKERANNFEHRIEDL    981 - 1050
TRQLRNSTLQCETINSDNEDLLARIETLQSNAKLLEVQILEVQRAKAMVDKELEAEKLQKEQKIKEHATT   1051 - 1120
VNELEELQVQLQKQKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKELNQKLTNKNNKIEDLEQEI   1121 - 1190
KIQKQKQETLQEEITSLQSSVQQYEEKNTKIKQLLVKTKKELADSKQAETDHLILQASLKGELEASQQQV   1191 - 1260
EVYKIQLAEITSEKHKIHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEFESYKVRVHNV   1261 - 1330
LKQQKNKSMSQAETEGAKQEREHLEMLIDQLKIKLQDSQNNLQINVSELQTLQSEHDTLLERHNKMLQET   1331 - 1400
VSKEAELREKLCSIQSENMMMKSEHTQTVSQLTSQNEVLRNSFRDQVRHLQEEHRKTVETLQQQLSKMEA   1401 - 1470
QLFQLKNEPTTRSPVSSQQSLKNLRERRNTDLPLLDMHTVTREEGEGMETTDTESVSSASTYTQSLEQLL   1471 - 1540
NSPETKLEPPLWHAEFTKEELVQKLSSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQERE   1541 - 1610
KSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLAAVAQGEEENASRSSGWASYLHSW   1611 - 1680
SGLR                                                                     1681 - 1684
//

Text Mined References (31)

PMID Year Title
26653856 2015 Protein flexibility is required for vesicle tethering at the Golgi.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22159419 2011 ARL4A acts with GCC185 to modulate Golgi complex organization.
21875948 2011 GCC185 plays independent roles in Golgi structure maintenance and AP-1-mediated vesicle tethering.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19703403 2009 The localization of the Golgin GCC185 is independent of Rab6A/A' and Arl1.
18946081 2009 Multiple Rab GTPase binding sites in GCC185 suggest a model for vesicle tethering at the trans-Golgi.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18243103 2008 Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185.
18195106 2008 A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17543864 2007 Asymmetric CLASP-dependent nucleation of noncentrosomal microtubules at the trans-Golgi network.
17488291 2007 The trans-Golgi network golgin, GCC185, is required for endosome-to-Golgi transport and maintenance of Golgi structure.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16885419 2006 A functional role for the GCC185 golgin in mannose 6-phosphate receptor recycling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15654769 2005 The trans-Golgi network GRIP-domain proteins form alpha-helical homodimers.
15522892 2004 Mammalian GRIP domain proteins differ in their membrane binding properties and are recruited to distinct domains of the TGN.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446665 2003 GRIP domain-mediated targeting of two new coiled-coil proteins, GCC88 and GCC185, to subcompartments of the trans-Golgi network.
12200376 2002 Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.