Property Summary

NCBI Gene PubMed Count 6
PubMed Score 45.52
PubTator Score 46.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.300 3.4e-03
urothelial carcinoma -1.600 2.2e-02
osteosarcoma -1.981 6.8e-06
active Crohn's disease 2.074 9.6e-04
ulcerative colitis 1.800 6.8e-05
sarcoidosis 1.300 1.7e-02
interstitial cystitis 1.500 1.0e-02
lung adenocarcinoma -1.600 1.1e-09
primary Sjogren syndrome 1.100 3.0e-02
pancreatic carcinoma -1.300 3.4e-03
inflammatory breast cancer 1.100 4.6e-02
lung carcinoma -2.700 6.9e-14
non-small cell lung carcinoma -1.400 9.8e-15
acute myeloid leukemia -1.300 3.9e-02
head and neck cancer and chronic obstruc... 1.100 3.2e-02

Gene RIF (5)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23867815 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVGLYRTGKSYLM      1 - 70
NRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEKSNPKNDSWIFALAVLLSSS     71 - 140
FVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTLELKLDGNPIT    141 - 210
EDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQS    211 - 280
DNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYS    281 - 350
QQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY    351 - 420
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQSQVVVEESIL    421 - 490
QSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQEYMAQMEKKLEEERENLLREH    491 - 560
ERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIESTKNEQLRLLKILDMASNIMIVTLPGASKLLG    561 - 630
VGTKYLGSRI                                                                631 - 640
//

Text Mined References (12)

PMID Year Title
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16689661 2006 In silico genomic analysis of the human and murine guanylate-binding protein (GBP) gene clusters.
16108726 2005 The guanylate-binding proteins (GBPs): proinflammatory cytokine-induced members of the dynamin superfamily with unique GTPase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9659399 1998 Cloning, expression, and characterization of a novel guanylate-binding protein, GBP3 in murine erythroid progenitor cells.