Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.01
PubTator Score 7.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 2.600 4.5e-03
astrocytoma 2.000 2.6e-09
Astrocytoma, Pilocytic 3.100 9.4e-05
ependymoma 2.900 7.9e-07
glioblastoma 2.000 2.7e-03
hepatocellular carcinoma 1.100 1.2e-04
juvenile dermatomyositis 2.902 8.7e-14
lung carcinoma -2.500 5.2e-19
non-small cell lung cancer -1.371 4.0e-05
ovarian cancer -2.500 2.0e-03
pancreatic cancer 1.200 4.2e-03
pituitary cancer -1.800 7.9e-03
primary pancreatic ductal adenocarcinoma 1.968 2.6e-02
primary Sjogren syndrome 1.400 7.7e-03
psoriasis 1.300 2.8e-20
subependymal giant cell astrocytoma 3.357 4.6e-03

Gene RIF (3)

AA Sequence

MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAVLLSSTLVYNSMGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQGT    141 - 210
SQKDKNFNLPRLCIRKFFPKKKCFVFDLPIHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL    211 - 280
SGGIKVNGPRLESLVLTYINAISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQE    281 - 350
LLDLHRVSEREATEVYMKNSFKDVDHLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEV    351 - 420
KAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQILTEKEKEIEVE    421 - 490
CVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQLLEEQEKTLTSKLQEQARVLK    491 - 560
ERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI                                       561 - 595
//

Text Mined References (14)

PMID Year Title