Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.66
PubTator Score 19.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (35)

Disease log2 FC p
chronic lymphocytic leukemia 1.357 1.1e-04
astrocytoma 1.600 5.6e-06
glioblastoma 2.500 5.2e-03
posterior fossa group A ependymoma 2.400 1.1e-04
cystic fibrosis 1.517 4.9e-04
limb girdle muscular dystrophy 2I 1.202 2.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.014 2.3e-03
juvenile dermatomyositis 2.900 7.7e-13
acute quadriplegic myopathy 1.580 1.3e-05
adrenocortical carcinoma -1.978 1.5e-03
chronic kidney disease 1.200 3.4e-02
pancreatic ductal adenocarcinoma liver m... 1.173 2.0e-02
intraductal papillary-mucinous adenoma (... 1.400 2.6e-03
intraductal papillary-mucinous carcinoma... 1.900 4.9e-03
intraductal papillary-mucinous neoplasm ... 2.000 4.2e-03
lung cancer -3.000 1.2e-06
colon cancer -1.300 5.2e-03
active Crohn's disease 1.986 1.2e-03
ulcerative colitis 1.700 5.3e-06
sarcoidosis 1.400 2.2e-02
pancreatic cancer 1.200 5.4e-04
diabetes mellitus -1.300 1.7e-03
adult high grade glioma 3.000 2.5e-04
pilocytic astrocytoma 3.900 5.1e-11
primary Sjogren syndrome 1.400 3.0e-02
aldosterone-producing adenoma -2.143 7.5e-03
subependymal giant cell astrocytoma 4.047 9.6e-04
Endometriosis -1.842 6.7e-03
lung carcinoma -2.600 4.3e-20
Pick disease 1.800 4.3e-02
Breast cancer -1.700 9.7e-08
gastric carcinoma 1.200 2.3e-02
ovarian cancer -1.200 2.5e-02
pituitary cancer -1.500 1.7e-04
dermatomyositis 2.000 6.2e-03

Protein-protein Interaction (10)

Gene RIF (11)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 2, interferon-inducible (GBP2) in primary human brain microvascular endothelial cells
23086406 GBP1/2 are critical effectors of antichlamydial interferon (IFN)gamma-mediated pathogen clearance via rerouting of bacterial inclusions in macrophages for lysosomal degradation.
23001506 Low GBP2 expression is associated with metastasis in breast cancer.
22864358 Downregulation of MIR-433 is associated with myeloproliferative neoplasms.
21151871 The in vivo localization of GBP-2 at cellular membranes is regulated by isoprenylation and dimerization.
20923658 hGBP-1, hGBP-2 showed dimerization-related GTPase activity for GMP formation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19912588 Guanylate-binding protein 2 mRNA in peripheral blood leukocytes may have a role in acute cellular rejection after liver transplantation
19003964 GBP-2 is regulated by p53 and may have a role in esophageal squamous cell carcinomas
17517895 Sky1p utilizes the same docking groove to bind yeast SR-like protein Gbp2p and phosphorylates all three serines present in a contiguous RS dipeptide stretch
12447867 Observational study of gene-environment interaction. (HuGE Navigator)

AA Sequence

MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMD     71 - 140
QLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGT    141 - 210
DKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTL    211 - 280
SGGIPVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE    281 - 350
LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV    351 - 420
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVE    421 - 490
RIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLK    491 - 560
EGFENESKRLQKDIWDIQMRSKSLEPICNIL                                           561 - 591
//

Text Mined References (25)

PMID Year Title
23086406 2013 Autophagy restricts Chlamydia trachomatis growth in human macrophages via IFNG-inducible guanylate binding proteins.
23001506 2014 Interferon-inducible guanylate binding protein (GBP2) is associated with better prognosis in breast cancer and indicates an efficient T cell response.
22970192 2012 Suppression of IFN-induced transcription underlies IFN defects generated by activated Ras/MEK in human cancer cells.
22864358 2013 miR-433 is aberrantly expressed in myeloproliferative neoplasms and suppresses hematopoietic cell growth and differentiation.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20923658 2010 Dimerization and its role in GMP formation by human guanylate binding proteins.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19912588 2010 Guanylate-binding protein 2 mRNA in peripheral blood leukocytes of liver transplant recipients as a marker for acute cellular rejection.
19003964 2009 Interferon-inducible guanylate binding protein (GBP)-2: a novel p53-regulated tumor marker in esophageal squamous cell carcinomas.
18985028 2008 Hepatitis C virus infection protein network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17517895 2007 Structurally unique yeast and mammalian serine-arginine protein kinases catalyze evolutionarily conserved phosphorylation reactions.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11096456 2000 Different subcellular localizations for the related interferon-induced GTPases, MuGBP-1 and MuGBP-2: implications for different functions?
8723115 1996 Differential display RT PCR of total RNA from human foreskin fibroblasts for investigation of androgen-dependent gene expression.
8706832 1996 GTPase properties of the interferon-induced human guanylate-binding protein 2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1715024 1991 Interferon-induced guanylate-binding proteins lack an N(T)KXD consensus motif and bind GMP in addition to GDP and GTP.