| Tbio | Guanylate-binding protein 2 |
Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions, but the major reaction product is GDP (PubMed:8706832). Exhibits antiviral activity against influenza virus. Promote oxidative killing and deliver antimicrobial peptides to autophagolysosomes, providing broad host protection against different pathogen classes (By similarity).
This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may play a role as a marker of squamous cell carcinomas. [provided by RefSeq, Jul 2013]
This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may play a role as a marker of squamous cell carcinomas. [provided by RefSeq, Jul 2013]
Comments
| Disease | Target Count |
|---|---|
| Myocardial Ischemia | 169 |
| PMID | Text | |
|---|---|---|
| 24667918 | Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 2, interferon-inducible (GBP2) in primary human brain microvascular endothelial cells | |
| 23086406 | GBP1/2 are critical effectors of antichlamydial interferon (IFN)gamma-mediated pathogen clearance via rerouting of bacterial inclusions in macrophages for lysosomal degradation. | |
| 23001506 | Low GBP2 expression is associated with metastasis in breast cancer. | |
| 22864358 | Downregulation of MIR-433 is associated with myeloproliferative neoplasms. | |
| 21151871 | The in vivo localization of GBP-2 at cellular membranes is regulated by isoprenylation and dimerization. | |
| 20923658 | hGBP-1, hGBP-2 showed dimerization-related GTPase activity for GMP formation. | |
| 20237496 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19912588 | Guanylate-binding protein 2 mRNA in peripheral blood leukocytes may have a role in acute cellular rejection after liver transplantation | |
| 19003964 | GBP-2 is regulated by p53 and may have a role in esophageal squamous cell carcinomas | |
| 17517895 | Sky1p utilizes the same docking groove to bind yeast SR-like protein Gbp2p and phosphorylates all three serines present in a contiguous RS dipeptide stretch | |
| 12447867 | Observational study of gene-environment interaction. (HuGE Navigator) |
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGST 1 - 70 VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMD 71 - 140 QLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGT 141 - 210 DKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTL 211 - 280 SGGIPVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE 281 - 350 LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV 351 - 420 KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVE 421 - 490 RIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLK 491 - 560 EGFENESKRLQKDIWDIQMRSKSLEPICNIL 561 - 591 //
| PMID | Year | Title | |
|---|---|---|---|
| 23086406 | 2013 | Autophagy restricts Chlamydia trachomatis growth in human macrophages via IFNG-inducible guanylate binding proteins. | |
| 23001506 | 2014 | Interferon-inducible guanylate binding protein (GBP2) is associated with better prognosis in breast cancer and indicates an efficient T cell response. | |
| 22970192 | 2012 | Suppression of IFN-induced transcription underlies IFN defects generated by activated Ras/MEK in human cancer cells. | |
| 22864358 | 2013 | miR-433 is aberrantly expressed in myeloproliferative neoplasms and suppresses hematopoietic cell growth and differentiation. | |
| 21151871 | 2010 | Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner. | |
| 20923658 | 2010 | Dimerization and its role in GMP formation by human guanylate binding proteins. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. | |
| 19912588 | 2010 | Guanylate-binding protein 2 mRNA in peripheral blood leukocytes of liver transplant recipients as a marker for acute cellular rejection. | |
| 19003964 | 2009 | Interferon-inducible guanylate binding protein (GBP)-2: a novel p53-regulated tumor marker in esophageal squamous cell carcinomas. | |
| 18985028 | 2008 | Hepatitis C virus infection protein network. | |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. | |
| 17517895 | 2007 | Structurally unique yeast and mammalian serine-arginine protein kinases catalyze evolutionarily conserved phosphorylation reactions. | |
| 17266443 | 2007 | Unique features of different members of the human guanylate-binding protein family. | |
| 16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12447867 | 2002 | Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study. | |
| 12107410 | 2002 | Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants. | |
| 11096456 | 2000 | Different subcellular localizations for the related interferon-induced GTPases, MuGBP-1 and MuGBP-2: implications for different functions? | |
| 8723115 | 1996 | Differential display RT PCR of total RNA from human foreskin fibroblasts for investigation of androgen-dependent gene expression. | |
| 8706832 | 1996 | GTPase properties of the interferon-induced human guanylate-binding protein 2. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. | |
| 1715024 | 1991 | Interferon-induced guanylate-binding proteins lack an N(T)KXD consensus motif and bind GMP in addition to GDP and GTP. |
