Property Summary

NCBI Gene PubMed Count 53
PubMed Score 111.10
PubTator Score 99.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (36)

Disease log2 FC p
hepatocellular carcinoma 1.800 5.6e-04
malignant mesothelioma -1.900 6.5e-07
esophageal adenocarcinoma 1.400 3.9e-02
psoriasis 3.200 4.6e-05
cutaneous lupus erythematosus 2.900 3.0e-04
astrocytoma 1.900 1.3e-07
glioblastoma multiforme 3.000 2.2e-19
oligodendroglioma 1.100 1.6e-03
osteosarcoma 1.901 1.2e-03
posterior fossa group A ependymoma 4.000 7.7e-13
juvenile dermatomyositis 4.882 2.2e-24
limb girdle muscular dystrophy 2I 1.134 4.8e-02
Atopic dermatitis 1.100 3.8e-02
primary pancreatic ductal adenocarcinoma 1.517 7.7e-03
tuberculosis and treatment for 6 months -1.200 3.9e-02
intraductal papillary-mucinous neoplasm ... 2.300 2.7e-02
Hydrolethalus syndrome -1.223 2.8e-02
lung cancer -2.800 1.1e-05
active Crohn's disease 3.086 7.1e-05
ulcerative colitis 3.000 2.6e-07
sarcoidosis 2.000 1.0e-02
pancreatic cancer 1.400 2.0e-03
Multiple Sclerosis 2.200 2.2e-03
interstitial cystitis 1.800 4.1e-03
cystic fibrosis 1.500 3.4e-03
adult high grade glioma 3.300 1.6e-05
pilocytic astrocytoma 3.100 1.1e-08
primary Sjogren syndrome 1.900 6.9e-04
aldosterone-producing adenoma -1.076 1.9e-02
subependymal giant cell astrocytoma 4.008 3.9e-03
nasopharyngeal carcinoma 1.300 1.2e-03
Pick disease 1.900 2.3e-02
invasive ductal carcinoma 1.300 9.4e-03
ovarian cancer 3.900 1.4e-06
pituitary cancer -2.500 7.1e-04
dermatomyositis 2.300 1.9e-02

Gene RIF (44)

PMID Text
26760981 GBP1 promotes lymph node metastasis and has a positive correlation with EGFR expression in esophageal squamous cell carcinoma.
25098609 GBP1 overexpression is necessary for the radioresistant phenotype in clinically relevant radioresistant cells
25081641 Molecular dynamics studies showed that only GTP decreases the formation of the GBP1:PIM1 complex through an allosteric mechanism, outlining the rational for the identification of new compounds potentially able to revert resistance to paclitaxel.
24991938 data show that dimer formation of hGBP1 involves multiple spatially distant regions of the protein, namely, the N-terminal LG domain and the C-terminal helices alpha13.
24337748 GBP-1 is a downstream processor of IFN-gamma.
24190970 GBP-1 is a novel member within the family of actin-remodeling proteins specifically mediating IFN-gamma-dependent defense strategies.
24190970 IFN-gamma-induced Guanylate Binding Protein-1 is a novel Actin Cytoskeleton Remodeling Factor. GBP-1 may induce actin remodeling via globular actin sequestering and/or filament capping. GBP-1 is a novel member within the family of actin remodeling proteins, specifically mediating IFN-gamma-dependent defense strategies.
24162774 HIV-1 gp120 downregulates the expression of interferon-inducible guanylate-binding protein 1 (GBP1) in human B cells
23727578 Data indicate that among three deductive p53 response element (p53RE) present in the hGBP1 promoter region, two p53REs were found to be transactivated by p53.
23086406 GBP1/2 are critical effectors of antichlamydial interferon (IFN)gamma-mediated pathogen clearance via rerouting of bacterial inclusions in macrophages for lysosomal degradation.
23042300 results suggested that GBP-1 acts directly as a tumor suppressor in CRC and the loss of GBP-1 expression might indicate tumor evasion from the IFN-gamma-dominated Th1 immune response.
23042300 GBP1 inhibits proliferation, migration, invasion and tumor formation of colon tumor cells.
22859948 Thermodynamic insight as to how the stability of an intermediate catalytic complex regulates the product formation in hGBP1.
22692453 Cytokine-induced GBP-1 retards cell proliferation by forming a negative feedback loop that suppresses beta-catenin / TCF signaling.
22607347 Data indicate that alpha12/13 represents a stable subdomain of guanylate-binding protein 1 (hGBP1).
22162832 establish GBP1 as a previously unknown link between EGFR activity and MMP1 expression and nominate it as a novel potential therapeutic target for inhibiting GBM invasion.
22059445 Data indicate that GBP1 guanine cap (i.e., C-terminal guanine-binding amino acid motif, particularly Arg240/Arg244) is key structural element responsible for dimerization and is essential for self-activation of GTPase activity.
21714544 higher GBP1 level in oral cavity squamous cell carcinoma tissue was associated with higher overall pathological stage, positive perineural invasion, and poorer prognosis
21151871 GBP-1 cellular 1ocalization depends on prenylation and dimerization.
20923658 hGBP-1, hGBP-2 showed dimerization-related GTPase activity for GMP formation.
20716116 Data indicate that GBP-1 contributes to vascular dysfunction in chronic inflammatory diseases by inhibiting endothelial progenitor cell (EPC) angiogenic activity via the induction of premature EPC differentiation.
20483731 These findings identify a role for IFN-alphaA-mediated GBP-1 expression in the prevention of intestinal epithelial apoptosis by commensal bacteria.
20454519 Animals carrying murine mammary carcinoma cells that had been given doxycycline for induction of human GBP-1 expression revealed a significantly reduced tumor growth compared with mock-treated mice.
20450919 Results identify intramolecular contacts of guanylate binding protein 1, which relay nucleotide-dependent structural changes from the N-terminus to the C-terminus and thereby mediate tetramer formation of the protein.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19463820 Positions of cysteine residues buried between the C-terminal domain of GBP1 and the rest of the protein are identified which report a large change of accessibility by the compound after addition of GTP.
19223260 The results indicate that the GBP1, STAT1 and CXCL10 may be novel risk genes for the differentiation of PBM at the monocyte stage.
19150356 The authors demonstrate for the first time that both the alpha-helix of the intermediate region and the (103)DXEKGD(108) motif play critical roles for the hydrolysis to GMP.
19079332 GBP-1 is a novel marker of intestinal mucosal inflammation that may protect against epithelial apoptosis induced by inflammatory cytokines and subsequent loss of barrier function
18697840 Inhibition of endothelial cell spreading and migration by inflammatory cytokines is mediated by GBP-1 through induction of ITGA4 expression.
18697200 GBP-1 may be a novel biomarker and an active component of a Th-1-like angiostatic immune reaction in colorectal carcinoma.
18260761 3 genes were upregulated in patients with chronic EBV infection: guanylate binding protein 1, tumor necrosis factor-induced protein 6, and guanylate binding protein 5; they may be associated with the inflammatory reaction or with cell proliferation.
16936281 Human guanylate binding protein-1 may be a useful surrogate marker for diagnosis of bacterial meningitis
16894355 Interferon-alpha upregulates GBP1 in cultured human vascular endothelial cells.
16873363 kinetic investigation of GTP hydrolysis catalyzed by interferon-gamma-induced hGBP1
16511497 crystal structures of the N-terminal G domain trapped at successive steps along the reaction pathway and biochemical data reveal the molecular basis for nucleotide-dependent homodimerization and cleavage of GTP
16005050 GBP-1 regulates anti-proliferative effect of inflammatory cytokines. It also mediates inhibition of endothelial cell invasiveness by down regulation of MMP-1[review]
15937107 Golgi targeting of human guanylate-binding protein-1 requires nucleotide binding, isoprenylation, and an IFN-gamma-inducible cofactor.
15504415 designed point mutants in the phosphate-binding loop (P-loop) as well as in the switch I and switch II regions. These mutant proteins were analysed for their interaction with guanine nucleotides and for their ability to hydrolyse GTP.
14741045 NF-kappaB motif and ISRE co-operate in the activation of GBP-1 expression by inflammatory cytokines in endothelial cells.
12881412 The GBP-1 GTPase controls the invasive and angiogenic capability of endothelial cells through inhibition of MMP-1 expression.
12414522 GBP-1 expression is selectively induced by inflammatory cytokines and is an activation marker of endothelial cells during inflammatory diseases.
11598000 The helical domain of GBP-1 mediates the inhibition of endothelial cell proliferation by inflammatory cytokines.

AA Sequence

MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGST      1 - 70
VQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKK    141 - 210
GTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTK    211 - 280
TLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETL    281 - 350
QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE    351 - 420
EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIE    421 - 490
VERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQL    491 - 560
LKEGFQKESRIMKNEIQDLQTKMRRRKACTIS                                          561 - 592
//

Text Mined References (59)

PMID Year Title
26760981 2015 Guanylate-binding protein 1 (GBP1) promotes lymph node metastasis in human esophageal squamous cell carcinoma.
25098609 2014 Guanine nucleotide-binding protein 1 is one of the key molecules contributing to cancer cell radioresistance.
25081641 2015 GTP is an allosteric modulator of the interaction between the guanylate-binding protein 1 and the prosurvival kinase PIM1.
24991938 2014 Triphosphate induced dimerization of human guanylate binding protein 1 involves association of the C-terminal helices: a joint double electron-electron resonance and FRET study.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24190970 2014 Gamma interferon-induced guanylate binding protein 1 is a novel actin cytoskeleton remodeling factor.
23727578 2013 Identification of human guanylate-binding protein 1 gene (hGBP1) as a direct transcriptional target gene of p53.
23086406 2013 Autophagy restricts Chlamydia trachomatis growth in human macrophages via IFNG-inducible guanylate binding proteins.
23042300 2013 GBP-1 acts as a tumor suppressor in colorectal cancer cells.
22859948 2012 Insight into temperature dependence of GTPase activity in human guanylate binding protein-1.
22692453 2012 IFN-? and TNF-?-induced GBP-1 inhibits epithelial cell proliferation through suppression of ?-catenin/TCF signaling.
22607347 2012 Tetramerization of human guanylate-binding protein 1 is mediated by coiled-coil formation of the C-terminal ?-helices.
22162832 2011 Guanylate binding protein 1 is a novel effector of EGFR-driven invasion in glioblastoma.
22106366 2012 A new splice variant of the human guanylate-binding protein 3 mediates anti-influenza activity through inhibition of viral transcription and replication.
22059445 2012 The guanine cap of human guanylate-binding protein 1 is responsible for dimerization and self-activation of GTP hydrolysis.
21714544 2011 Identification of guanylate-binding protein 1 as a potential oral cancer marker involved in cell invasion using omics-based analysis.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20923658 2010 Dimerization and its role in GMP formation by human guanylate binding proteins.
20716116 2011 Role of guanylate binding protein-1 in vascular defects associated with chronic inflammatory diseases.
20483731 2010 Commensal Escherichia coli reduces epithelial apoptosis through IFN-alphaA-mediated induction of guanylate binding protein-1 in human and murine models of developing intestine.
20454519 Interferon gamma-induced human guanylate binding protein 1 inhibits mammary tumor growth in mice.
20450919 2010 Mechanism of GTPase-activity-induced self-assembly of human guanylate binding protein 1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19463820 2009 Nucleotide dependent cysteine reactivity of hGBP1 uncovers a domain movement during GTP hydrolysis.
19223260 2009 An in vivo genome wide gene expression study of circulating monocytes suggested GBP1, STAT1 and CXCL10 as novel risk genes for the differentiation of peak bone mass.
19150356 2009 Role of individual domains and identification of internal gap in human guanylate binding protein-1.
19079332 2009 Guanylate-binding protein-1 is expressed at tight junctions of intestinal epithelial cells in response to interferon-gamma and regulates barrier function through effects on apoptosis.
18697840 2008 Guanylate binding protein-1 inhibits spreading and migration of endothelial cells through induction of integrin alpha4 expression.
18697200 2008 Angiostatic immune reaction in colorectal carcinoma: Impact on survival and perspectives for antiangiogenic therapy.
18260761 2008 Oligonucleotide microarray analysis of gene expression profiles followed by real-time reverse-transcriptase polymerase chain reaction assay in chronic active Epstein-Barr virus infection.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16936281 2006 Human guanylate binding protein-1 is a secreted GTPase present in increased concentrations in the cerebrospinal fluid of patients with bacterial meningitis.
16894355 2006 Interferon-alpha prevents apoptosis of endothelial cells after short-term exposure but induces replicative senescence after continuous stimulation.
16873363 2006 Transient kinetic investigation of GTP hydrolysis catalyzed by interferon-gamma-induced hGBP1 (human guanylate binding protein 1).
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16511497 2006 How guanylate-binding proteins achieve assembly-stimulated processive cleavage of GTP to GMP.
16005050 2005 Human guanylate binding protein-1 (hGBP-1) characterizes and establishes a non-angiogenic endothelial cell activation phenotype in inflammatory diseases.
15937107 2005 Golgi targeting of human guanylate-binding protein-1 requires nucleotide binding, isoprenylation, and an IFN-gamma-inducible cofactor.
15504415 2004 Identification of residues in the human guanylate-binding protein 1 critical for nucleotide binding and cooperative GTP hydrolysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14741045 2004 Nuclear factor-kappaB motif and interferon-alpha-stimulated response element co-operate in the activation of guanylate-binding protein-1 expression by inflammatory cytokines in endothelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12881412 2003 The guanylate binding protein-1 GTPase controls the invasive and angiogenic capability of endothelial cells through inhibition of MMP-1 expression.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12488461 2002 The human plasma proteome: history, character, and diagnostic prospects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414522 2002 Guanylate-binding protein-1 expression is selectively induced by inflammatory cytokines and is an activation marker of endothelial cells during inflammatory diseases.
11598000 2001 The helical domain of GBP-1 mediates the inhibition of endothelial cell proliferation by inflammatory cytokines.
11397834 2001 Messenger ribonucleic acid encoding interferon-inducible guanylate binding protein 1 is induced in human endometrium within the putative window of implantation.
10970849 2000 Triphosphate structure of guanylate-binding protein 1 and implications for nucleotide binding and GTPase mechanism.
10676968 2000 Structure of human guanylate-binding protein 1 representing a unique class of GTP-binding proteins.
10383748 1999 Regulation of guanylate-binding protein expression in interferon-gamma-treated human epidermal keratinocytes and squamous cell carcinoma cells.
8830800 1996 Prenylation of an interferon-gamma-induced GTP-binding protein: the human guanylate binding protein, huGBP1.
7518790 1994 The interferon-inducible GBP1 gene: structure and mapping to human chromosome 1.
1715024 1991 Interferon-induced guanylate-binding proteins lack an N(T)KXD consensus motif and bind GMP in addition to GDP and GTP.