Property Summary

NCBI Gene PubMed Count 68
PubMed Score 3.86
PubTator Score 62.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 4.6e-04
osteosarcoma 7933 2.9e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 4.6e-04
osteosarcoma -1.260 2.9e-03

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26718629 Oligomerization appears to stabilize GBF1 in cells.
25653442 The role of GBF1 in poliovirus replication is independent of its Arf activating function.
25410869 Although human rhinovirus 3A protein was previously shown to interact with ACBD3, these data suggest that PI4KIIIbeta recruitment occurred independently of both GBF1 and ACBD3.
24855065 GBF1 plays a critical role early in dengue infection that is independent of its role in the maintenance of Golgi structure.
24213530 GBF1 causes increased Arf-GTP production at the Golgi, consistent with a feed-forward self-limiting mechanism of Arf activation.
23418352 These data suggest that AMPK-GBF1-Arf1 signaling is involved in the regulation of Golgi fragmentation during mitosis.
23386609 an early acting GEF (GBF1) activates ARFs that mediate recruitment of late acting GEFs (BIG1/2) to coordinate coating events within the pre-Golgi/Golgi/TGN continuum.
22573891 GBF1-mediated Arf1 activation is necessary to unify cell polarity during chemotaxis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22359663 the vesicular transport proteins ARF1 and GBF1 colocalized with PI4KIIIbeta and were both required for HCV replication
22185782 The GBF1 participated in delivery of adipose triglyceride lipase (ATGL) onto the lipid droplets(LD) surface
21909260 We hypothesize that sphingomyelin acquired by CERT-dependent transport of ceramide and subsequent conversion to SM is necessary for C. trachomatis replication whereas SM acquired by GBF1-dependent pathway is essential for inclusion growth and stability.
21789191 GBF1 and ATGL interact directly and in cells, through multiple contact sites on each protein.
21722633 The COG (conserved oligomeric Golgi) complex plays a role in the localization, but not membrane association of GBF1.
20854417 Both human and canine GBF1 can be inhibited by compound LG186, a small molecule derived from Exo2, a small molecule inhibitor of secretion and Shiga toxin cytotoxicity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530568 Data suggest that Rab1 contributes to the specificity and timing of GBF1 recruitment by activating PI4KIIIalpha, and that the PtdIns(4)P produced then allows GBF1 to bind to Golgi membranes and activate Arf1.
20497182 The brefeldin A block of poliovirus replication is rescued by expression of only the N-terminal region of GBF1 lacking the Sec7 domain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20175751 Data propose that the phosphorylation and membrane dissociation of GBF1 and the consequent reduction in ARF-GTP levels in mitosis are important for changes in Golgi dynamics
20164217 The authors demonstrate that Rab1b-activated GBF1 and ARF1 are involved in Ebolavirus virion formation, suggesting that both the COPII and COPI transport systems play a role in Ebolavirus VP40-mediated particle formation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906930 GBF1 is a cellular factor required for HCV infection.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19740986 crucial for coxsackievirus B3 RNA replication
19023417 GBF1 is responsible for the sensitivity of poliovirus infection to BFA, and is required for virus replication
18799457 AG1478 inhibits GBF1, a large nucleotide exchange factor for the ADP-ribosylation factor, in a Sec7 domain-dependent manner and mimics the phenotype of a GBF1 mutant that has an inactive mutation
18551169 siRNAs demonstrate that GBF1-mediated ARF1 activation is required for efficient MHV RNA replication
18524849 GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1
18287014 Unfolded protein response and cell death after depletion of brefeldin A-inhibited guanine nucleotide-exchange protein GBF1.
18063581 GBF1 is a AMPK substrate and AMPK-mediated phosphorylation of GBF1 at Thr(1337) has a critical role, presumably by attenuating function of GBF1, in disassembly of the Golgi apparatus induced under stress conditions that lower the intracellular ATP
18003980 COPII is the only coat required for sorting and export from the endoplasmic reticulum exit sites, whereas GBF1, but not BIGs, is required for COPI recruitment, Golgi subcompartmentalization, and cargo progression to the cell surface.
17956946 These findings suggest that a secretory pathway capable of trafficking soluble proteins can be maintained in cells in which COPI recruitment is compromised by GBF1 depletion.
17666033 Required for GGA adaptor protein recruitment to Golgi membranes; plays a role in the proper processing and sorting of lysosomal cargo.
17429068 These data support a model where Rab1b-GTP induces GBF1 recruitment at the ERES interface and at the Golgi complex where it is required for COPII/COPI exchange or COPI vesicle formation, respectively.
17329336 analysis of the binding domain in GBF1 showed that the extreme N terminus, the dimerization/cyclophilin binding domain, and the homology upstream of Sec7 domain are required for the interaction with coxsackievirus protein 3A
17079330 Two different poliovirus proteins independently recruit different Arf GEFs (GBF1 and BIG1/2) to membranes as part of cellular pathways utilized by the virus to form its membranous replication complex.
16926190 These observations strongly suggest that GBF1 regulates COPI membrane recruitment in the early secretory pathway.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16318580 GBF1 is recruited to the endogenous IRF-9 promoter, and interacts with C/EBP-beta, IL-1, and IL-6
15813748 A continuous cycle of recruitment and dissociation of GBF1 to membranes is required for sustained ARF activation and COP I recruitment that underlies ER-Golgi traffic.
15616190 an Arf1-GBF1-Brefeldin A complex is formed and has a longer residence time on Golgi membranes than GBF1 or Arf1 alone
12646181 characterization of alternatively spliced and truncated forms of GBF1 defines regions important for activity
12634853 novel interaction between p115 and Golgi-specific brefeldin-A-resistant factor 1 (GBF1)
12047556 detailed subcellular localization to the cis-Golgi

AA Sequence

MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLE      1 - 70
VIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGMENMADAVTHARFVGTDPASDEVVLMKILQVL     71 - 140
RTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTN    141 - 210
MKKLKMRAGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSE    211 - 280
AASAVVSPSTDSGLEFSSQTTSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASV    281 - 350
ESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR    351 - 420
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESMREH    421 - 490
LKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLS    491 - 560
KNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTAS    561 - 630
DGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEAVDSGADKKFARKPPRFSCLLPDPRELIEIKNKK    631 - 700
KLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVST    701 - 770
FSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNH    771 - 840
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATP    841 - 910
EGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIIS    911 - 980
LCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMIEV    981 - 1050
EDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMI   1051 - 1120
TESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQ   1121 - 1190
DFCFLVERAVVGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG   1191 - 1260
DDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPG   1261 - 1330
KIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTKSLLKCVESLSFIV   1331 - 1400
RDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHAS   1401 - 1470
RGGQSDDDEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAH   1471 - 1540
CWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVG   1541 - 1610
GMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDT   1611 - 1680
AEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGDTRT   1681 - 1750
PGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVG   1751 - 1820
VPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEVN                                  1821 - 1859
//

Text Mined References (84)

PMID Year Title
26718629 2016 Oligomerization of the Sec7 domain Arf guanine nucleotide exchange factor GBF1 is dispensable for Golgi localization and function but regulates degradation.
25653442 2015 Cell-specific establishment of poliovirus resistance to an inhibitor targeting a cellular protein.
25410869 2015 GBF1- and ACBD3-independent recruitment of PI4KIII? to replication sites by rhinovirus 3A proteins.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24855065 2014 Quantitative proteomic analysis of host-virus interactions reveals a role for Golgi brefeldin A resistance factor 1 (GBF1) in dengue infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24213530 2014 Arf activation at the Golgi is modulated by feed-forward stimulation of the exchange factor GBF1.
23418352 2013 AMPK phosphorylates GBF1 for mitotic Golgi disassembly.
23386609 2013 The Sec7 guanine nucleotide exchange factor GBF1 regulates membrane recruitment of BIG1 and BIG2 guanine nucleotide exchange factors to the trans-Golgi network (TGN).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22573891 2012 GBF1 bears a novel phosphatidylinositol-phosphate binding module, BP3K, to link PI3K? activity with Arf1 activation involved in GPCR-mediated neutrophil chemotaxis and superoxide production.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22359663 2012 ARF1 and GBF1 generate a PI4P-enriched environment supportive of hepatitis C virus replication.
22185782 2011 GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
21909260 2011 Chlamydia trachomatis co-opts GBF1 and CERT to acquire host sphingomyelin for distinct roles during intracellular development.
21789191 2011 Interaction between the triglyceride lipase ATGL and the Arf1 activator GBF1.
21722633 2011 Mislocalization of large ARF-GEFs as a potential mechanism for BFA resistance in COG-deficient cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20854417 2010 LG186: An inhibitor of GBF1 function that causes Golgi disassembly in human and canine cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20530568 2010 The phosphatidylinositol 4-kinase PI4KIIIalpha is required for the recruitment of GBF1 to Golgi membranes.
20504936 2010 Differential effects of the putative GBF1 inhibitors Golgicide A and AG1478 on enterovirus replication.
20497182 2010 Poliovirus replication requires the N-terminus but not the catalytic Sec7 domain of ArfGEF GBF1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20175751 2010 Phosphorylation and membrane dissociation of the ARF exchange factor GBF1 in mitosis.
20164217 2010 Role of the GTPase Rab1b in ebolavirus particle formation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906930 2010 Identification of GBF1 as a cellular factor required for hepatitis C virus RNA replication.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19740986 2009 GBF1, a guanine nucleotide exchange factor for Arf, is crucial for coxsackievirus B3 RNA replication.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19461073 2009 Coatomer-dependent protein delivery to lipid droplets.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19039328 2009 A COPI coat subunit interacts directly with an early-Golgi localized Arf exchange factor.
19023417 2008 A critical role of a cellular membrane traffic protein in poliovirus RNA replication.
18799457 2008 A novel small molecule regulator of guanine nucleotide exchange activity of the ADP-ribosylation factor and golgi membrane trafficking.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18551169 2008 Mouse hepatitis coronavirus RNA replication depends on GBF1-mediated ARF1 activation.
18524849 2008 Characterization of class I and II ADP-ribosylation factors (Arfs) in live cells: GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1.
18287014 2008 Unfolded protein response and cell death after depletion of brefeldin A-inhibited guanine nucleotide-exchange protein GBF1.
18088087 2008 Phosphoproteome of resting human platelets.
18084281 2008 GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
18063581 2008 AMP-activated protein kinase phosphorylates Golgi-specific brefeldin A resistance factor 1 at Thr1337 to induce disassembly of Golgi apparatus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003980 2008 Distinct functions for Arf guanine nucleotide exchange factors at the Golgi complex: GBF1 and BIGs are required for assembly and maintenance of the Golgi stack and trans-Golgi network, respectively.
17956946 2007 Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.
17666033 2007 The Arf GEF GBF1 is required for GGA recruitment to Golgi membranes.
17640864 2007 Interactions between conserved domains within homodimers in the BIG1, BIG2, and GBF1 Arf guanine nucleotide exchange factors.
17429068 2007 Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17329336 2007 Molecular determinants of the interaction between coxsackievirus protein 3A and guanine nucleotide exchange factor GBF1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17079330 2007 Hijacking components of the cellular secretory pathway for replication of poliovirus RNA.
17005635 2006 Effects of picornavirus 3A Proteins on Protein Transport and GBF1-dependent COP-I recruitment.
16956762 2006 Insights into COPI coat assembly and function in living cells.
16926190 2006 GBF1, a cis-Golgi and VTCs-localized ARF-GEF, is implicated in ER-to-Golgi protein traffic.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16318580 2005 Development of monoclonal antibodies against GBF1 and their use in studying its functions.
15813748 2005 Dissection of membrane dynamics of the ARF-guanine nucleotide exchange factor GBF1.
15616190 2005 Dynamics of GBF1, a Brefeldin A-sensitive Arf1 exchange factor at the Golgi.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12808027 2003 ADP-ribosylation factor/COPI-dependent events at the endoplasmic reticulum-Golgi interface are regulated by the guanine nucleotide exchange factor GBF1.
12646181 2003 Characterization of alternatively spliced and truncated forms of the Arf guanine nucleotide exchange factor GBF1 defines regions important for activity.
12634853 2003 The membrane-tethering protein p115 interacts with GBF1, an ARF guanine-nucleotide-exchange factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12047556 2002 GBF1, a guanine nucleotide exchange factor for ADP-ribosylation factors, is localized to the cis-Golgi and involved in membrane association of the COPI coat.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10402461 1999 GBF1: A novel Golgi-associated BFA-resistant guanine nucleotide exchange factor that displays specificity for ADP-ribosylation factor 5.
9828135 1998 Human GBF1 is a ubiquitously expressed gene of the sec7 domain family mapping to 10q24.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.