Property Summary

NCBI Gene PubMed Count 40
PubMed Score 219.11
PubTator Score 147.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney disease 430 0.0 2.1
Disease Target Count Z-score Confidence
AGAT deficiency 6 7.171 3.6

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.100 4.3e-02
aldosterone-producing adenoma -2.134 5.8e-03
Astrocytoma, Pilocytic 1.300 2.0e-03
atypical teratoid / rhabdoid tumor -1.600 3.8e-02
Breast cancer -1.800 2.4e-05
cutaneous lupus erythematosus -1.700 2.0e-04
Down syndrome 1.100 1.5e-03
group 3 medulloblastoma -2.500 4.3e-03
interstitial cystitis -1.200 2.0e-03
intraductal papillary-mucinous adenoma (... -3.800 2.2e-03
intraductal papillary-mucinous carcinoma... -4.800 1.8e-04
intraductal papillary-mucinous neoplasm ... -2.200 1.8e-02
lung adenocarcinoma 1.012 1.5e-02
lung cancer -1.400 2.3e-03
medulloblastoma, large-cell -1.100 9.9e-03
nephrosclerosis -1.480 2.9e-02
osteosarcoma 3.103 7.3e-04
ovarian cancer -3.400 2.7e-07
pancreatic cancer -1.600 4.0e-03
pancreatic ductal adenocarcinoma liver m... -2.760 2.1e-02
psoriasis -1.300 4.1e-07
sarcoidosis 1.200 1.8e-02
subependymal giant cell astrocytoma -2.187 4.7e-02

PDB (11)

Gene RIF (11)

AA Sequence

MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYN      1 - 70
EWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVT     71 - 140
VRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKW    141 - 210
TTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEW    211 - 280
MRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHP    281 - 350
LWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS    351 - 420
YLD                                                                       421 - 423
//

Text Mined References (46)

PMID Year Title