Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.39
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 2.000 1.1e-02
ependymoma 1.500 2.0e-02
oligodendroglioma 1.700 2.5e-03
psoriasis 1.900 3.6e-04
glioblastoma 1.500 3.7e-03
osteosarcoma 4.302 3.5e-10
atypical teratoid / rhabdoid tumor 1.200 2.7e-05
primitive neuroectodermal tumor 1.100 1.3e-03
adult high grade glioma 1.400 4.2e-05
Pick disease 1.200 4.7e-04
ovarian cancer -1.500 7.3e-08

Gene RIF (3)

PMID Text
24462704 GATAD1 expression was significantly decreased in the third-trimester placentas associated with preeclampsia than those associated with normal pregnancy.
21965549 GATAD1 mutation is associated with autosomal recessive dilated cardiomyopathy.
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSA      1 - 70
TPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAE     71 - 140
SIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEE    141 - 210
DLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL               211 - 269
//

Text Mined References (16)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24462704 2014 Decreased expression and DNA methylation levels of GATAD1 in preeclamptic placentas.
21965549 2011 Homozygosity mapping and exome sequencing reveal GATAD1 mutation in autosomal recessive dilated cardiomyopathy.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12062807 2002 Ocular development-associated gene (ODAG), a novel gene highly expressed in ocular development.
8401586 1993 Chromosomal distribution of 320 genes from a brain cDNA library.
1538749 1992 Sequence identification of 2,375 human brain genes.