Property Summary

NCBI Gene PubMed Count 113
PubMed Score 243.53
PubTator Score 177.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Atrial heart septal defect 15 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -4.400 1.8e-09
Barrett's esophagus 2.200 4.3e-02
esophageal adenocarcinoma 3.300 1.8e-02
psoriasis -1.400 2.5e-05
cystic fibrosis -1.580 6.8e-05
atypical teratoid / rhabdoid tumor 2.100 2.4e-02
medulloblastoma, large-cell 2.400 1.8e-02
Atopic dermatitis -1.400 1.3e-03
adrenocortical carcinoma -1.500 9.1e-03
non-small cell lung cancer -2.671 3.7e-20
intraductal papillary-mucinous adenoma (... 1.100 1.0e-03
X-linked cerebral adrenoleukodystrophy 2.100 4.3e-02
lung cancer -2.000 1.5e-04
interstitial cystitis -1.100 8.6e-03
sonic hedgehog group medulloblastoma 1.900 1.2e-02
lung adenocarcinoma -2.000 1.2e-08
nasopharyngeal carcinoma 1.500 1.4e-03
Polycystic Ovary Syndrome 1.504 2.2e-02
lung carcinoma -1.200 3.2e-23
Breast cancer -1.700 3.6e-05
ulcerative colitis -1.200 4.9e-04
ovarian cancer -5.300 2.6e-06

Protein-protein Interaction (3)

Gene RIF (92)

PMID Text
26505174 Our results, for the first time, portray a pivotal role of GATA6 in regulating metastatic behaviors of breast cancer cells
26387746 GATA6 induces expression of genes essential for growth of colon cancer cells under adherent conditions (REG4) and genes required for their clonogenicity (LGR5), and miR-363-GATA6-REG4/LGR5 signaling cascade promotes tumorigenicity of colon cancer cells.
25969542 data indicated that GATA-6 and Akt2 are involved in the mTORC1-mediated regulation of VSMC proliferation and differentiation.
25872572 miR-181b was upregulated by hypoxia in retinoblastoma in an HIF-1a-independent manner. Additionally, miR-181b exerts its angiogenic function, at least in part, by inhibiting PDCD10 and GATA6.
25706805 results show how genetic mutations in GATA6 may lead to functional inactivity and pancreatic agenesis in humans
25596178 In the pancreas, Gata6 acts as a tumour suppressor by enforcing acinar cell differentiation, by directly and indirectly repressing ectopic differentiation programmes, and by regulating crucial cancer-related gene expression pathways.
25445407 GATA6 expression is progressively increased during Barrett's oesophagus development and its malignant transformation to esophageal adenocarcinoma.
25119427 association of GATA6 loss-of-function mutations with enhanced susceptibility to familial dilated cardiomyopathy
25053715 KLF5/GATA4/GATA6 may promote gastric cancer development by engaging in mutual crosstalk, collaborating to maintain a pro-oncogenic transcriptional regulatory network in gastric cancer cells.
25036032 SNPs within the GATA6 gene promoter identified in ventricular septal defects patients may change GATA6 levels, contributing to the VSD development as a risk factor.
25015078 These results establish SHP as a novel antihypertrophic regulator that acts by interfering with GATA6 signaling.
24949533 DNA sequence variants within the GATA6 gene promoter may contribute to the IIH development as a risk factor by changing the GATA6 levels
24841381 Three heterozygous missense mutationsof GATA-binding factor 6, c.151G>A (E51K), c.551G>A (S184N) and c.733G>C (G245R), were identified in patients with tetralogy of Fallot or persistent truncus arteriosus.
24603652 GATA6, which is hypomethylated and abundant in endometriotic cells, potently blocked hormone sensitivity, repressed GATA2, and induced markers of endometriosis when expressed in healthy endometrial cells.
24531914 Data suggest that levels of GATA6 in subcapsular zone of adrenal glands (zona glomerulosa) are not prominently different in subjects with primary aldosteronism, subjects with aldosterone-producing adrenocortical adenomas, or normal subjects.
24385578 The results show that de novo mutations in GATA6 contribute to the development of congenital diaphragmatic hernia.
24317510 analysis of the GATA6 transcriptional regulation in gastric cancer
24310933 Based on the data presented in this paper, we conclude that the heterozygous nonsense mutation, p.Arg493X of GATA6 resulted in pancreatic agenesis and congenital heart defects.
24179092 FOG1, FOG2 and GATA-6 modulate the transcriptional up-regulation of HAMP in hepatocytes during inflammation.
24089524 nicotine induced the binding of GATA4 or GATA6 to Sp1 on the alpha7-nAChR promoter, thereby inducing its transcription and increasing its levels in human SCC-L.
23784465 GATA6 overexpression is associated with hepatic metastasis of colorectal cancer.
23746070 Spontaneously differentiated GATA6-expressed human embryonic stem cells represent an important cellular step in human embryonic development.
23707782 GATA6 and HOPX are critical nodes in a lineage-selective pathway that directly links effectors of airway epithelial specification to the inhibition of metastasis in the lung ADC subtype.
23635550 Our 2 cases with novel GATA6 mutations add more phenotype characteristics of GATA6 haploinsufficiency
23583651 Endothelial GATA-6 plays a critical role in the molecular mechanisms underlying endothelial cell dysfunction in pulmonary arterial hypertension.
23313142 Data suggest that GATA6 was an independent prognostic marker for overall survival and recurrence-free survival in cholangiocarcinoma (CCA).
23275439 The study characterized the CPI-17 promoter and identified binding sites for GATA-6 and nuclear factor kappa B (NF-kappaB).
23223019 mutation screening in 171 subjects with neonatal diabetes of unknown genetic etiology: Data suggest that GATA6 mutations account for a wide spectrum of neonatal diabetes; GATA6 mutations appear to be the major cause of pancreatic agenesis.
23175051 This is the first report on the association of somatic GATA6 loss-of-function mutation with increased susceptibility to Tetralogy of Fallot.
23158662 Novel mutations identified in the GATA6 gene are associated with tetralogy of Fallot.
23020118 Data indicate that two novel heterozygous GATA6 mutations, p.D404Y and p.E460X, were identified in two families with ventricular septal defect and tetralogy of Fallot, respectively.
22962692 Dominantly inherited diabetes mellitus caused by GATA6 haploinsufficiency.
22824924 A novel heterozygous GATA6 mutation, p.G469V, was identified in a family with atrial fibrillation inherited in an autosomal dominant pattern.
22806356 GATA6 inactivating mutations are associated with heart defects and, inconsistently, with pancreatic agenesis and diabetes.
22750565 GATA6 mutation was identified in a patient with atrial fibrillation and co-segregated with the disease as an autosomal dominant trait in the family.
22672670 High methylation frequency of tested genes shows heterogeneity of glioblastoma epigenome and the importance of MGMT, GATA6 and CASP8 genes methylation in glioblastoma patient outcome.
22504665 Results imply that miRNA-145 indirectly targets BMP4 via GATA6 and is potentially involved in the development of Barrett Esophagus (BE).
22407241 The entire coding region of the GATA6 gene, which encodes a zinc-finger transcription factor crucial to normal cardiogenesis, was sequenced in 130 unrelated patients with congenital ventricular septal defect.
22375031 Selective gene amplification of GATA6 during esophageal adenocarcinomas development sustains oncogenic lineage-survival of esophageal adenocarcinoma.
22257684 GATA6 mutations predispose to AF may be partially ascribed to the abnormally developed pulmonary vein myocardium
22158542 These findings define the most common cause of human pancreatic agenesis and establish a key role for the transcription factor GATA6 in human pancreatic development.
21928112 The methylation status at the promoter regions of GATA6, MGMT, and FHIT in glioblastoma, was examined.
21811562 GATA6 promotes pancreatic carcinogenesis by virtue of its activation of canonical Wnt signaling via regulation of DKK1.
21629665 The study individuates GATA6 as novel player in the complex transcriptional regulation of mesoangioblast differentiation into SM cells and highlights a role for S1P to favour vascular regeneration.
21514437 GATA-6 acts as a transcriptional repressor of CAV1 gene expression in partial bladder outlet obstruction-induced bladder wall smooth muscle hypertrophy
21127043 GATA6 plays a crucial role for endothelial cell function and survival, at least in part, by suppressing autocrine TGFbeta expression and ALK5-dependent signaling.
21076612 Data show that GATA6 is an important regulator of uPA gene expression, and the dysregulated expression of GATA6 contributes to colorectal tumorigenesis and tumor invasion.
21071980 Results suggest that the expression of GATA-6 at the early stages of the preterm lung may be related to impaired postnatal alveolar development.
20864106 PTEN selectively inhibits expression of VCAM-1 but not ICAM-1 through modulation of PI3K/Akt/GSK-3beta/GATA-6 signaling cascade in TNF-alpha-treated endothelial cells
20826533 GATA6 is required for the activation of Pdgfra expression in the inner cell mass of the implanting mammalian blastocyst.
20631719 All these data suggest that GATA6 Ser184Asn is a novel mutation associated with CHDs and has an important role in disease pathogenesis.
20631719 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20581743 Data suggest that nonsynonymous GATA6 sequence variants are infrequently found in individuals with congenital heart defects.
20581743 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19666519 mutations in GATA6 are genetic causes of congenital heart diseases involving outflow tract defects, as a result of the disruption of the direct regulation of semaphorin 3C-plexin A2 signaling
19649254 loss of GATA4 expression through changes in chromatin conformation suggests a potential non-phenotypic initiating event, leading to subsequent loss of GATA6, morphological transformation, and ultimate tumorigenesis
19597127 The hallmark of idiopathic pulmonary fibrosis histopathology, the fibroblast focus, consists of differentiated, quiescent cells that prominently express GATA-6.
19581290 Results suggest that diminished expression of GATA6 leads to a compromised nuclear envelope that is causal for polyploidy and aneuploidy in ovarian tumorigenesis.
19497978 MED1 and GATA-6 are key regulators of SULT2A1 expression, and they play important roles in adrenal androgen production.
18769116 Gain and overexpression of the development-related transcription factor GATA-6 may play an important and hitherto unrecognized role in pancreatic carcinogenesis
18535672 GATA6 amplification and overexpression contribute to the oncogenic phenotypes of pancreatic cancer cells.
18454176 MEK-ERK-dependent phosphorylation of GATA-6 plays a role in upregulation of transcription of Nox1
18405344 The results suggest differential but overlapping functions for GATA-4 and GATA-6 in the normal gastrointestinal mucosa. Furthermore, GATA-4, GATA-6 and Ihh expression is altered in premalignant dysplastic lesions and reduced in overt cancer.
18227727 the majority of the ovarian surface epithelial carcinomas retained GATA-4 expression, whereas approximately two-thirds of the carcinomas had mislocalization or loss of GATA-6 expression
18177748 We demonstrated that overexpression of GATA-6 in fibroblasts inhibited basal levels, as well as markedly decreased IL-4- and TGF-beta-induced TN-C mRNA and protein levels.
18078765 Results describe the cyclic AMP-dependent proteolysis of GATA-6 expressed on the intracellular membrane.
17785913 GATA-6 expression is involved in the regulation of corticosteroid production in both the human fetal and adult adrenals, as well as in adrenocortex development.
17626241 functional role for GATA-6 in regulation of bladder smooth muscle differentiation
17403900 Cooperative interaction between HNFA4 and GATA4 and GATA6 regulates ABCG5 and ABCG8.
17390031 WNT8B expression in hepatocyte progenitors derived from human ES cells is due to POU5F1 (OCT3/OCT4) and GATA3, and WNT8B expression in diffuse-type gastric cancer is due to POU5F1 and GATA6
17070195 Observational study of gene-disease association. (HuGE Navigator)
16968778 Results identify a conserved function for endodermal GATA transcription factors GATA6 and ELT-2 in regulating local epithelial innate immune responses.
16607277 Altered histone modification of the promoter loci is one mechanism responsible for the silencing of GATA transcription factors.
16159937 In polycystic ovary syndrome(PCOS) theca cells, GATA6 gene transcription and stability of GATA6 mRNA are increased. Increased gene transcription and mRNA stability are likely due to intrinsic differences in PCOS theca cells.
16150495 GATA6 is expressed in adult mouse brain and several regions of adult human brain. GATA6 is found in neurons, astrocytes, choroids plexus epithelium, and endothelial cells.
16137232 expression of GATA-4 and GATA-6 is up-regulated prior to the transcriptional activation of Nkx 2.5 during cardiogenesis
16110260 GATA-6 detected in ovarian GCTs has retained normal function; exclusive expression of GATA-6 and HNF-4 in endodermal tissues indicates these transcription factors play role in differentiation of germ cells towards endodermal phenotype
15913546 analysis of cAMP-dependent proteolysis of GATA-6
15831526 cytochrome b5 gene transcription is regulated by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells
15666845 Steroidogenically active human adrenocortical cells were weakly positive for GATA-4, whereas steroidogenically inactive cells were totally GATA-4 negative. In contrast, both cell lines expressed GATA-6.
15388788 Both steroidogenic factor 1 and GATA-6 were positive regulators of Steroid sulfotransferase 2A1 promoter constructs
12959982 Adrenal uses GATA-6 to enhance transcription of steroid-metabolizing enzymes needed to produce dehydroepiandrosterone sulfate. Additionally, GATA-6 works in synergy with SF1 to maximally increase expression of enzymes needed to produce adrenal androgens.
12909592 Normal postnatal morphogenesis of the lung depends upon precise temporal-spatial regulation of GATA-6.
12867597 GATA-6 was expressed in most yolk sac tumors examined and also in nonmalignant tissues including gut/respiratory epithelium, sebocytes, and neuroepithelium in mature and immature teratomas
12679484 GATA-6 did not correlate with apoptosis or cell proliferation and is therefore unlikely to be directly involved in these processes in the human fetal testis
12615657 The activation of PPARgamma-dependent pathways induces the differentiated phenotype in proliferative VSMCs, and this induction is mediated, in part, through a GATA-6-dependent transcriptional mechanism.
12606287 role in trans-activation of bone morphogenetic protein 4 and regulation of mammalian organogenesis
12530677 GATA-4 and GATA-6 mRNAs are readily detectable from gestational week 19 in human adrenal cortex.

AA Sequence

MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA      1 - 70
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA     71 - 140
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS    141 - 210
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG    211 - 280
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP    281 - 350
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM    351 - 420
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT    421 - 490
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL    491 - 560
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA                                       561 - 595
//

Text Mined References (117)

PMID Year Title
26505174 2015 GATA6 is overexpressed in breast cancer and promotes breast cancer cell epithelial-mesenchymal transition by upregulating slug expression.
26387746 2015 REG4 is a transcriptional target of GATA6 and is essential for colorectal tumorigenesis.
25969542 2015 Phosphorylation of GATA-6 is required for vascular smooth muscle cell differentiation after mTORC1 inhibition.
25872572 2015 Hypoxia-induced miR-181b enhances angiogenesis of retinoblastoma cells by targeting PDCD10 and GATA6.
25706805 2015 Novel GATA6 mutations in patients with pancreatic agenesis and congenital heart malformations.
25596178 2016 The acinar regulator Gata6 suppresses KrasG12V-driven pancreatic tumorigenesis in mice.
25445407 2015 GATA6 expression in Barrett's oesophagus and oesophageal adenocarcinoma.
25119427 2014 GATA6 loss-of-function mutations contribute to familial dilated cardiomyopathy.
25053715 2015 Regulatory crosstalk between lineage-survival oncogenes KLF5, GATA4 and GATA6 cooperatively promotes gastric cancer development.
25036032 2014 Novel and functional DNA sequence variants within the GATA6 gene promoter in ventricular septal defects.
25015078 2014 Small heterodimer partner blocks cardiac hypertrophy by interfering with GATA6 signaling.
24949533 2014 Two functional sequence variants of the GATA6 gene promoter in patients with indirect inguinal hernia.
24841381 2014 Identification of two novel GATA6 mutations in patients with nonsyndromic conotruncal heart defects.
24603652 2014 Genome-wide DNA methylation analysis predicts an epigenetic switch for GATA factor expression in endometriosis.
24531914 2014 GATA6, SF1, NGFIB and DAX1 in the remodeled subcapsular zones in primary aldosteronism.
24385578 2014 Whole exome sequencing identifies de novo mutations in GATA6 associated with congenital diaphragmatic hernia.
24317510 2014 An integrative analysis reveals functional targets of GATA6 transcriptional regulation in gastric cancer.
24310933 2014 A case of pancreatic agenesis and congenital heart defects with a novel GATA6 nonsense mutation: evidence of haploinsufficiency due to nonsense-mediated mRNA decay.
24179092 2013 Friend of GATA and GATA-6 modulate the transcriptional up-regulation of hepcidin in hepatocytes during inflammation.
24089524 2013 Nicotine induces the up-regulation of the ?7-nicotinic receptor (?7-nAChR) in human squamous cell lung cancer cells via the Sp1/GATA protein pathway.
23784465 2013 GATA6 predicts prognosis and hepatic metastasis of colorectal cancer.
23746070 2013 Spontaneously differentiated GATA6-positive human embryonic stem cells represent an important cellular step in human embryonic development; they are not just an artifact of in vitro culture.
23707782 2013 Control of alveolar differentiation by the lineage transcription factors GATA6 and HOPX inhibits lung adenocarcinoma metastasis.
23635550 2013 Two novel GATA6 mutations cause childhood-onset diabetes mellitus, pancreas malformation and congenital heart disease.
23583651 2013 Endothelial GATA-6 deficiency promotes pulmonary arterial hypertension.
23313142 2013 Aberrant expression of GATA binding protein 6 correlates with poor prognosis and promotes metastasis in cholangiocarcinoma.
23275439 2013 GATA-6 and NF-?B activate CPI-17 gene transcription and regulate Ca2+ sensitization of smooth muscle contraction.
23223019 2013 GATA6 mutations cause a broad phenotypic spectrum of diabetes from pancreatic agenesis to adult-onset diabetes without exocrine insufficiency.
23175051 2013 Somatic mutations in the GATA6 gene underlie sporadic tetralogy of Fallot.
23158662 2012 [Identification of novel mutations in GATA6 gene associated with tetralogy of Fallot].
23020118 2012 Novel GATA6 mutations associated with congenital ventricular septal defect or tetralogy of fallot.
22962692 2012 Dominantly inherited diabetes mellitus caused by GATA6 haploinsufficiency: variable intrafamilial presentation.
22824924 2012 Novel GATA6 loss-of-function mutation responsible for familial atrial fibrillation.
22806356 2012 GATA6 inactivating mutations are associated with heart defects and, inconsistently, with pancreatic agenesis and diabetes.
22750565 2012 GATA6 loss-of-function mutation in atrial fibrillation.
22672670 2012 MGMT, GATA6, CD81, DR4, and CASP8 gene promoter methylation in glioblastoma.
22504665 2013 microRNA-145 in Barrett's oesophagus: regulating BMP4 signalling via GATA6.
22407241 2012 A novel GATA6 mutation associated with congenital ventricular septal defect.
22375031 2012 Activation of GATA binding protein 6 (GATA6) sustains oncogenic lineage-survival in esophageal adenocarcinoma.
22257684 2012 Prevalence and spectrum of GATA6 mutations associated with familial atrial fibrillation.
22158542 2011 GATA6 haploinsufficiency causes pancreatic agenesis in humans.
21928112 2012 The promoter hypermethylation status of GATA6, MGMT, and FHIT in glioblastoma.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
21811562 2011 GATA6 activates Wnt signaling in pancreatic cancer by negatively regulating the Wnt antagonist Dickkopf-1.
21629665 2011 Sphingosine 1-phosphate induces differentiation of mesoangioblasts towards smooth muscle. A role for GATA6.
21514437 2011 Transcriptional repression of Caveolin-1 (CAV1) gene expression by GATA-6 in bladder smooth muscle hypertrophy in mice and human beings.
21127043 2011 GATA6 promotes angiogenic function and survival in endothelial cells by suppression of autocrine transforming growth factor beta/activin receptor-like kinase 5 signaling.
21076612 2010 GATA6 promotes colon cancer cell invasion by regulating urokinase plasminogen activator gene expression.
21071980 2011 Expression of Transcription Factor GATA-6 in Alveolar Epithelial Cells Is Linked to Neonatal Lung Disease.
20864106 2010 PTEN differentially regulates expressions of ICAM-1 and VCAM-1 through PI3K/Akt/GSK-3?/GATA-6 signaling pathways in TNF-?-activated human endothelial cells.
20826533 2010 A role for PDGF signaling in expansion of the extra-embryonic endoderm lineage of the mouse blastocyst.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20631719 2010 A novel GATA6 mutation in patients with tetralogy of Fallot or atrial septal defect.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581743 2010 Identification of GATA6 sequence variants in patients with congenital heart defects.
20206639 2010 The transcription factor GATA-4 regulates cytochrome P4502C19 gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19666519 2009 GATA6 mutations cause human cardiac outflow tract defects by disrupting semaphorin-plexin signaling.
19649254 2009 Loss of GATA4 and GATA6 expression specifies ovarian cancer histological subtypes and precedes neoplastic transformation of ovarian surface epithelia.
19597127 2010 Transcription factor GATA-6 is expressed in quiescent myofibroblasts in idiopathic pulmonary fibrosis.
19581290 2009 Loss of GATA6 leads to nuclear deformation and aneuploidy in ovarian cancer.
19497978 2009 The mediator complex subunit 1 enhances transcription of genes needed for adrenal androgen production.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18769116 2008 Frequent genomic copy number gain and overexpression of GATA-6 in pancreatic carcinoma.
18671946 2008 Statins activate GATA-6 and induce differentiated vascular smooth muscle cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18535672 2008 Genomic profiling identifies GATA6 as a candidate oncogene amplified in pancreatobiliary cancer.
18454176 2008 Oncogenic Ras upregulates NADPH oxidase 1 gene expression through MEK-ERK-dependent phosphorylation of GATA-6.
18405344 2008 Transcription factors GATA-4 and GATA-6 in normal and neoplastic human gastrointestinal mucosa.
18227727 2008 GATA-4 and GATA-6 expression in human ovarian surface epithelial carcinoma.
18177748 2008 GATA-6 is a novel transcriptional repressor of the human Tenascin-C gene expression in fibroblasts.
18078765 2008 Cyclic AMP-dependent proteolysis of GATA-6 expressed on the intracellular membrane.
17848411 2007 Developmental changes in human fetal testicular cell numbers and messenger ribonucleic acid levels during the second trimester.
17785913 2007 Transcription factor GATA-6 in the human adrenocortex: association with adrenal development and aging.
17626241 2007 GATA-6 mediates human bladder smooth muscle differentiation: involvement of a novel enhancer element in regulating alpha-smooth muscle actin gene expression.
17403900 2007 Cooperative interaction between hepatocyte nuclear factor 4 alpha and GATA transcription factors regulates ATP-binding cassette sterol transporters ABCG5 and ABCG8.
17390031 2007 Conserved POU/OCT- and GATA-binding sites in 5'-flanking promoter region of mammalian WNT8B orthologs.
17070195 2006 Polymorphism in HSD17B6 is associated with key features of polycystic ovary syndrome.
16968778 2006 A conserved role for a GATA transcription factor in regulating epithelial innate immune responses.
16607277 2006 Histone modifications silence the GATA transcription factor genes in ovarian cancer.
16199874 2005 Hey basic helix-loop-helix transcription factors are repressors of GATA4 and GATA6 and restrict expression of the GATA target gene ANF in fetal hearts.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16159937 2005 Increased transcription and increased messenger ribonucleic acid (mRNA) stability contribute to increased GATA6 mRNA abundance in polycystic ovary syndrome theca cells.
16150495 2005 Expression of GATA6 in the human and mouse central nervous system.
16137232 2005 GATA factors lie upstream of Nkx 2.5 in the transcriptional regulatory cascade that effects cardiogenesis.
16110260 Transcription factors GATA-4 and GATA-6, and their potential downstream effectors in ovarian germ cell tumors.
15913546 2005 Characterization of cAMP-dependent proteolysis of GATA-6.
15831526 2005 Regulation of cytochrome b5 gene transcription by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells.
15666845 2004 Transcription factors GATA-4 and GATA-6 in human adrenocortical tumors.
15388788 2005 Steroid sulfotransferase 2A1 gene transcription is regulated by steroidogenic factor 1 and GATA-6 in the human adrenal.
15173203 2004 A unique role of an amino terminal 16-residue region of long-type GATA-6.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15016828 2004 Interaction between hex and GATA transcription factors in vascular endothelial cells inhibits flk-1/KDR-mediated vascular endothelial growth factor signaling.
14988427 2004 GATA-4 and GATA-6 modulate tissue-specific transcription of the human gene for P450c17 by direct interaction with Sp1.
12959982 2003 GATA-6 is expressed in the human adrenal and regulates transcription of genes required for adrenal androgen biosynthesis.
12909592 2003 Inhibition of alveolarization and altered pulmonary mechanics in mice expressing GATA-6.
12867597 2003 Transcription factor GATA-6 is expressed in malignant endoderm of pediatric yolk sac tumors and in teratomas.
12679484 2003 Transcription factor GATA-6, cell proliferation, apoptosis, and apoptosis-related proteins Bcl-2 and Bax in human fetal testis.
12615657 2003 GATA-6 is involved in PPARgamma-mediated activation of differentiated phenotype in human vascular smooth muscle cells.
12606287 2003 Transcriptional activation of BMP-4 and regulation of mammalian organogenesis by GATA-4 and -6.
12530967 2003 Cysteine-rich LIM-only proteins CRP1 and CRP2 are potent smooth muscle differentiation cofactors.
12530677 2002 Transcription factors GATA-4 and GATA-6 during mouse and human adrenocortical development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889139 2002 Calcineurin-GATA-6 pathway is involved in smooth muscle-specific transcription.
11733512 2002 GATA-6 and thyroid transcription factor-1 directly interact and regulate surfactant protein-C gene expression.
11724781 2002 Defects of the heart, eye, and megakaryocytes in peroxisome proliferator activator receptor-binding protein (PBP) null embryos implicate GATA family of transcription factors.
10851229 2000 A p300 protein as a coactivator of GATA-6 in the transcription of the smooth muscle-myosin heavy chain gene.
10608869 1999 The human and mouse GATA-6 genes utilize two promoters and two initiation codons.
9593712 1998 GATA-6 induces p21(Cip1) expression and G1 cell cycle arrest.
9566909 1998 Distinct functions are implicated for the GATA-4, -5, and -6 transcription factors in the regulation of intestine epithelial cell differentiation.
9315713 1997 GATA-6 DNA binding protein expressed in human gastric adenocarcinoma MKN45 cells.
9294001 1997 Molecular cloning of human GATA-6 DNA binding protein: high levels of expression in heart and gut.
8975704 1996 The human GATA-6 gene: structure, chromosomal location, and regulation of expression by tissue-specific and mitogen-responsive signals.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.