Property Summary

NCBI Gene PubMed Count 193
PubMed Score 736.76
PubTator Score 438.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 3.600 5.5e-09
primary pancreatic ductal adenocarcinoma -1.268 1.3e-02
gastric carcinoma -1.800 4.1e-02
ovarian cancer -3.300 1.6e-14
pancreatic cancer -1.400 3.5e-03
psoriasis 1.300 1.0e-02

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (168)

PMID Text
26946174 results demonstrate that cGMP-PKG signaling mediates transcriptional activity of GATA4 and links defective GATA4 and PKG-1alpha mutations to the development of human heart disease.
26490736 Kaplan-Meier survival analysis revealed significantly shorter overall survival in pediatric Acute myeloid leukemia with GATA4 promoter methylation but multivariate analysis shows that it is not an independent factor.
26404840 GATA4 accumulates in multiple tissues, including the aging brain, and could contribute to aging and its associated inflammation.
26381449 This study showed that GATA4 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.
26376067 Whole exome sequencing results on four-generation Chinese family with atrial septal defect (ASD) identified a novel mutation in GATA4 gene at the methylation position associated with ASD.
26071180 Data show that the combination of GATA binding protein 4 (Gata4), T-box transcription factor 5 (Tbx5) and BRG1-associated factor 60C protein (Baf60c) is sufficient for inducing adipose tissue-derived mesenchymal stem cells (ADMSCs) to form cardiomyocytes.
25928801 GATA4 genetic variations are associated with congenital heart disease
25873328 this study confirms that GATA4 M310V mutation may lead to the development of the congenital heart defect, ASD.
25524324 Germline mutations in the NKX2-5, GATA4, and CRELD1 genes do not appear to be associated with CHD in Mexican DS patients.
25416133 Lower levels of Gata4 expression enhanced cardiac myocyte reprogramming efficiency.
25272520 We identified 17 mutations, including five non-synonymous sequence changes, one synonymous variant and one variation in the 5' UTR, three intronic changes and seven deletions. We found no evidence of gene GATA4 somatic sequence variants
25099673 we identified a mutation in the GATA4 Kozak sequence that likely contributes to the pathogenesis of Atrial septal defect.
25053715 KLF5/GATA4/GATA6 may promote gastric cancer development by engaging in mutual crosstalk, collaborating to maintain a pro-oncogenic transcriptional regulatory network in gastric cancer cells.
25025186 No copy number variations of the gene were detected. GST pull-down assays demonstrated that all potentially deleterious variants, including those previously reported, did not impair the interaction with GATA4
25017055 3 novel heterozygous GATA4 mutations, p.V39L, p.P226Q and p.T279S, were identified in 3 unrelated patients with sporadic dilated cardiomyopathy. The altered amino acids after missense mutations were completely conserved across species.
24973415 The present study is the first to suggest that GATA-4 gene methylation status may independently predict health status in individuals with COPD.
24866383 NEXN as a novel gene for ASD and its function to inhibit GATA4 established a critical regulation of an F-actin binding protein on a transcription factor in cardiac development
24862985 GATA4 plays important roles in the progression of breast carcinoma from an early stage and immunohistochemical GATA4 status is considered a potent prognostic factor in human breast cancer patients.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24696446 The results show that GATA4 mutations/deletions are a cause of neonatal or childhood-onset diabetes with or without exocrine insufficiency.
24687970 In conclusion HER2 and GATA4 are new molecular prognostic markers of GCT recurrence, which could be utilized to optimize the management and follow-up of patients with early-stage GCTs
24681789 Early cardiac marker gene GATA4 levels in peripheral blood mononuclear cells reflect severity in stable coronary artery disease.
24651021 Study showed that there is significantly higher methylation in GATA4 gene in the endometrial cancer group compared with samples of non-neoplastic endometrium.
24505034 We found that both of these factors significantly suppressed gelsolin-induced cardiac hypertrophy through p38/GATA4 signaling pathway.
24498650 A novel GATA4 mutation, c.955ANG (p.K319E), was identified.
24416423 The molecular interactions of FOXL2, GATA4, and SMAD3 and their roles in the regulation of CCND2 using co-immunoprecipitation, promoter transactivation, and cell viability assays in human granulosa cell tumor cells, were investigated.
24415412 Mesenchymal GATA4 activity regulates hepatic stellate cell activation and inhibits the liver fibrogenic process.
24366163 The findings expand the mutational spectrum of GATA4 linked to Dilated cardiomyopathy and provide novel insight into the molecular etiology involved in DCM.
24365599 Observations have uncovered novel functions of miR-200c and GATA4 in regulating hESC renewal and differentiation.
24330461 Our study identified the GATA4 transcription factor as an independent risk factor for congenital heart disease and coronary artery disease, myocardial infarction and a metabolic risk trait for cardiovascular diseases.
24314346 Lower alcohol-cue-induced activations in G-allele carriers as compared with AA-homozygotes in the bilateral amygdala. A stronger alcohol-specific amygdala response predicted a lowered risk for relapse to heavy drinking in the AA-homozygotes.
24284823 Variants in the human GATA4 locus are associated with an increased risk for type-1 diabetes mellitus.
24182332 DNA methylation status of NKX2-5, GATA4 and HAND1 in patients with tetralogy of fallot
24145767 These results confirm that methylation in the GATA4 promoter region could play an important role in ovarian carcinogenesis, and show new loci which are highly methylated only in ovarian cancer samples
24089524 nicotine induced the binding of GATA4 or GATA6 to Sp1 on the alpha7-nAChR promoter, thereby inducing its transcription and increasing its levels in human SCC-L.
24083978 These findings demonstrate a novel ERRgamma/GATA4 signal cascade in the development of cardiac hypertrophy.
24041700 the GATA4 mutant was associated with significantly decreased transcriptional activity and remarkably reduced synergistic activation
24000169 GATA4 loss-of-function mutations underlie familial tetralogy of fallot.
23888774 Expression level of PPP3R1 and GATA4, and NFATC4 genes for transcription factors did not differ in studied subgroups of patients.
23746174 Significantly higher methylation was observed in genes NTKR1, GATA4 and WIF1 in the ovarian cancer group compared with the control group.
23745586 C-terminus of GATA4 is critical to maintain DNA binding.
23626780 Functional mutations in GATA4 in patients with congenital heart disease included effects on transcriptional activity, subcellular localization and DNA binding affinity of some of the mutant GATA4 proteins.
23320456 GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival.
23239811 Results thus identify a novel epigenetic mechanism by which MYC activates GATA4 leading to metastasis in lung adenocarcinoma.
23215884 we found a relationship between genetic variation in GATA-4 and the acenocoumarol maintenance dose
23138528 Identified a novel GATA binding protein 4 (GATA4) variant in a familial case of congenital diaphragmatic hernia (CDH), using whole exome sequencing (WES), and identified a de novo GATA4 variant in sporadic CDH.
23029311 Sex Cord Stromal Tumors in childhood exhibited an embryonal gonadal phenotype, expressing a FOG-2/GATA-4 pattern in keeping with embryonal gonads.
22959235 genomic GATA4 and TFAP2B missense mutations may be associated with nonfamilial congenital heart disease with diverse clinical phenotypes in patients with congenital heart disease from southern China
22862823 Our findings provide evidence of association between alcohol dependence and variation in GATA4 at the gene level.
22773876 a novel role for GATA-4 and TAL1 to affect skeletal myogenic differentiation and EPO response via cross-talk with Sirt1.
22648249 These findings expand the mutation spectrum of GATA4 linked to ventricular septal defect.
22552926 The findings expand the mutation spectrum of GATA4 linked to Atrial fibrillation (AF), and further support the notion that compromised GATA4 confers genetic susceptibility to AF.
22500510 data suggest that these sequence variants within the promoter region of the GATA4 gene may contribute to the ventricular septal defect etiology by altering its gene expression
22472323 The results indicated that histone deacetylation is a silencing mechanism for GATA4 expression in AFP-producing gastric cancer cells.
22101736 The p.R43W variant was predicted to be a pathogenic mutation, and the functional analysis demonstrated that the GATA4 R43W mutant protein resulted in significantly decreased transcriptional activity compared with its wild-type counterpart.
22043484 Somatic mutations in NKX2-5, GATA4, and HAND1 are not a common cause of tetralogy of Fallot or hypoplastic left heart.
22018271 Heterogeneous methylation in the promoter region of GATA4 was associated with cancer progression in non-small cell lung cancer.
22011241 NKX2-5 and GATA4 were the first congenital heart defects-causing genes identified by linkage analysis in large affected families.
21945496 The combination of different sources of data has revealed an association of GATA4 with triglyceride levels in humans.
21933911 Cardiac defects are infrequent findings in individuals with 8p23.1 genomic duplications containing GATA4.
21874226 Two novel heterozygous GATA4 mutations of p.G16C and p.H28D, were identified in 2 unrelated Chinese families with atrial fibrillation.
21834050 This case suggests that the gene for GATA4, a transcription factor previously implicated in early cardiac development, is a candidate gene for the Left ventricular noncompaction phenotype.
21815254 In the 28 of 32 nonsyndromic patients who underwent molecular testing, no mutation in GATA4 and NKX2.5 genes were detected.
21708142 Two novel heterozygous GATA4 mutations, p.S70T and p.S160T in patients with familial atrial fibrillation
21673957 the common GATA4 variant S377G is likely to be relatively benign in terms of its participation in congenital heart defect and Patent foramen ovale/stroke
21637914 The findings expand the spectrum of mutations in GATA4 linked to ventricular septal defects and provide more insight into the molecular mechanism involved in VSD.
21631294 The involvement of specific SNPs of GATA4 in the manifestation of congenital heart defects, reported for the first time in an Indian scenario.
21609320 The findings of the present study (i) indicate that GATA-4 may participate in the control of hepcidin expression, and (ii) suggest that alteration of its expression could contribute to the development of iron-related disorders.
21519287 Our study shows no evidence of somatic NKX2-5, GATA4 and HAND1 mutations playing a role in the pathogenesis of Tetralogy of Fallot . Findings suggest that the GATA4 and HAND1 germline mutations are associated with non-syndromic congenital heart disease.
21464220 Re-expression of GATA4 in human glioblastoma Multiforme cell lines, primary cultures, and brain tumor-initiating cells suppressed tumor growth in vitro
21373748 The findings underscore the pathogenic link between compromised GATA4 function and congenital Atrial septal defect , providing new insight into the molecular mechanism involved in this common form of congenital cardiovascular anomalies.
21330551 show that Gata4 and Smad4 cooperatively activated the Id2 promoter, that human GATA4 mutations abrogated this activity, and that Id2 deficiency in mice could cause atrioventricular septal defects
21276881 Study identified NKX2.5 and GATA4 constitutional variants in CHD cohort.
21220346 Data demonstrate the key role of GATA4 in human testicular development.
21110066 GATA4 missense mutations may be associated with congenital heart defects in pediatric Chinese patients.
21055141 Two novel mutations of GATA4 gene are identified in two unrelated congenital atrial septal defect patients.
21055141 Observational study of gene-disease association. (HuGE Navigator)
20931527 A novel missense GATA4 mutation leads to congenital ventricular septal defect.
20874241 these data do not support GATA4 mutations as a common cause of congenital heart malformation.
20807224 Observational study of gene-disease association. (HuGE Navigator)
20659440 T280M mutation of GATA4 is suggested to be associated with atrial septal defect in Chinese family
20654103 Three novel heterozygous missense GATA4 mutations were identified in patients with congenital atrial septal defect.
20654103 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595226 Studies identify a novel link between wood smoke exposure and gene promotor methylation of the p16 and GATA4 genes that synergistically increases the risk for reduced lung function in cigarette cmokers.
20592452 GATA4 copy number variations was not associated with congenital heart disease.
20592452 Observational study of gene-disease association. (HuGE Navigator)
20585342 genetic variations in GATA4 might influence relapse and treatment response to acamprosate in alcohol-dependent patients via modulation of atrial natriuretic peptide plasma levels.
20585342 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554787 Overexpressing GATA4 protects granulosa cell tumors from TRAIL-induced apoptosis.
20450724 The mutated GATA4 gene may be responsible for congenital heart disease in a subset of patients.
20450724 Observational study of gene-disease association. (HuGE Navigator)
20363377 Mutations in the cardiac transcription factor GATA4 is associated with lone atrial fibrillation.
20363377 Observational study of gene-disease association. (HuGE Navigator)
20347099 Identified a novel M310V mutation in GATA4 gene that leads to hereditary atrial septal defect in a Chinese family.
20222162 Epigenetic inactivation of GATA-4 by methylation of CpG islands is an early frequent event during gastric carcinogenesis and is significantly correlated with H. pylori infection.
20206639 These data indicate that GATA-4 plays an important role in the transcriptional regulation of CYP2C19 expression
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20133952 In cooperation with Cdx2, HNF-1alpha acts as a key factor on human intestinal cells to trigger the onset of their functional differentiation program whereas GATA-4 appears to promote morphological changes.
20081228 Cdk9 forms a functional complex with the p300/GATA4 and is required for p300/GATA4- transcriptional pathway during cardiomyocyte hypertrophy
20041118 The 5' region of the mouse, rat, and human GATA4 genes, was characterized.
19995889 Data suggest GATA-4 may be involved in up-regulation of expression of CYP2C9 in hepatocytes.
19918328 These findings support previous studies implicating GATA4 in pancreatic cancer and offer new avenues for investigation into this aggressive tumor type.
19915893 Mutations in GATA4 might be related to congenital cardiac septal defects in Han ancestry patients
19915893 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19781215 Mutations in the transcription factor GATA-4 may be related to congenital cardiac septal defects in Han Chinese patients.
19678963 Analysis of the genetic background of the parents of the patient showed for the first time that a new mutation of GATA4 can cause sporadic atrial septal defects
19678963 Observational study of gene-disease association. (HuGE Navigator)
19649254 loss of GATA4 expression through changes in chromatin conformation suggests a potential non-phenotypic initiating event, leading to subsequent loss of GATA6, morphological transformation, and ultimate tumorigenesis
19543315 GATA4 is expressed in the embryonic and adult CNS and acts as a negative regulator of astrocyte proliferation and growth.
19509152 Methylation of GATA4/5 is a common and specific event in colorectal carcinomas, and GATA4/5 exhibit tumor suppressive effects in colorectal cancer cells in vitro. GATA4 methylation in fecal DNA may be of interest for colorectal cancer detection.
19479054 This study suggests that NKX2-5 modulates the beta-catenin and GATA4 transcriptional activities in developing human cardiac myocytes.
19353638 elevated levels of GATA4 protein, due to a GATA4 gene duplication are not sufficient to cause congenital heart disease.
19353247 TGF-beta1 drives GATA-4 expression during intestinal inflammation, these two components cooperating to promote epithelial healing.
19302747 The results provided the primary data on congenital heart disease phenotype associated with GATA4 mutation in the Chinese Uygur population.
19302747 Observational study of gene-disease association. (HuGE Navigator)
19276186 It is proposed that the negative feedback loop linking ERBB2 and GATA4 plays a role in the transcriptional dysregulation of ERBB2 gene expression in breast cancer.
19018306 Observational study of gene-disease association. (HuGE Navigator)
19008335 GATA4 mutations would have a lesser impact on gonadal gene transcription and function.
18983250 Translocation of the transcription factors NKX2.5 and GATA4 to the nucleus was observed in all the cultures of mesenchymal stem cells during the differentiation process.
18672102 findings are useful in understanding the prevalence of GATA4 mutations and the correlation between the GATA4 genotype and the congenital heart disease phenotype in Chinese patients
18672102 Observational study of gene-disease association. (HuGE Navigator)
18653721 GATA-4 influences granulosa cell fate by transactivating Bcl-2.
18426912 HNF4alpha regulates thyroid hormone homeostasis through transcriptional regulation of the Dio1 gene with GATA4 and KLF9
18405344 The results suggest differential but overlapping functions for GATA-4 and GATA-6 in the normal gastrointestinal mucosa. Furthermore, GATA-4, GATA-6 and Ihh expression is altered in premalignant dysplastic lesions and reduced in overt cancer.
18227727 the majority of the ovarian surface epithelial carcinomas retained GATA-4 expression, whereas approximately two-thirds of the carcinomas had mislocalization or loss of GATA-6 expression
18076106 identification of a novel GATA4 mutation in a patients with ASDII
18055909 Observational study of gene-disease association. (HuGE Navigator)
18055909 4 missense sequence variants (Gly93Ala, Gln316Glu, Ala411Val, Asp425Asn) occurred in patients with cardiac septal defects. 2 led to polarity changes. Non-synonymous GATA4 sequence variants sometimes occur in septal defects & rarely in conotruncal defects.
17912029 While hypermethylation of GATA-5 seems to be a universal feature among human tumors, infrequent methylation of GATA-4, and its corresponding overexpression, appears unique to pancreatic cancer from other tumor types reported thus far.
17805225 Observational study of gene-disease association. (HuGE Navigator)
17643447 Observational study of gene-disease association. (HuGE Navigator)
17643447 These data establish the phenotypic spectrum of heterozygous Gata4 mutation in mice, and suggest that heterozygous GATA4 mutation leads to partially overlapping phenotypes in humans.
17592645 somatic GATA4 mutations in the 3'-UTR may provide an additional molecular rationale for congenital heart disease
17584735 Tbx18 interacts with Gata4 and Nkx2-5 and competes Tbx5-mediated activation of the cardiac Natriuretic peptide precursor type a-promoter. Tbx18 down-regulates Tbx6-activated Delta-like 1 expression in the somitic mesoderm in vivo
17548362 analysis of the nuclear shuttling pathways of GATA-4 that represent an additional mechanism of gene regulation
17403900 Cooperative interaction between HNFA4 and GATA4 and GATA6 regulates ABCG5 and ABCG8.
17352393 Observational study of genotype prevalence. (HuGE Navigator)
17352393 GATA4 mutations that result in deficits in transactivation ability are consistently associated with congenital heart disease suggesting that normal transactivation properties of GATA4 are required for proper cardiac development.
17290010 TGF-beta signaling regulates gut epithelial gene expression by targeting GATA4.
17253934 Observational study of genotype prevalence. (HuGE Navigator)
17253934 GATA4 mutations are relatively rare among congenital heart disease patients.
17211834 Data show that Oct-4, Rex-1, and Gata-4 expression in human mesenchymal stem cells increases cell differentiation efficiency but not hTERT expression.
16823849 Frequent silencing of GATA-4 and GATA-5 in human esophageal neoplasia is associated with gene promoter hypermethylation.
16607277 Altered histone modification of the promoter loci is one mechanism responsible for the silencing of GATA transcription factors.
16604480 two novel GATA4 mutations associated with congenital heart defects in Chinese patients. This suggests that the transcription factor GATA4 may play an important role in cardiogenesis
16470721 a GATA4 mutation may have a role in Tetralogy of Fallot
16337738 Methylation of GATA-4 was associated with ovarian carcinogenesis
16159935 Aggressive granulosa cell tumors(GCTs) retain high GATA-4 expression, whereas larger tumors lose proliferation-suppressing anti-Mullerian hormone expression. High GATA-4 expression in GCTs may serve as marker of poor prognosis.
16137232 expression of GATA-4 and GATA-6 is up-regulated prior to the transcriptional activation of Nkx 2.5 during cardiogenesis
16110260 GATA-4 detected in ovarian GCTs has retained normal function
15666845 Steroidogenically active human adrenocortical cells were weakly positive for GATA-4, whereas steroidogenically inactive cells were totally GATA-4 negative. In contrast, both cell lines expressed GATA-6.
15653675 NKX2.5 inhibits myocyte differentiation and myotube formation, and up-regulates Gata4 and Tbx5 expression
15585625 Hypermethylation of the GATA4 is associated with lung cancer
15389642 optimal claudin-2 expression in the gut relies on the presence of GATA-4, suggesting a role for this factor in intestinal regionalization
15337742 GATA4 is a SUMO-1-targeted transcription factor and together with PIAS1 is a potent regulator of cardiac gene activity
15235040 A novel atrial septal defect causative GATA4 mutation in a Japanese family.
15153544 transcription factors GATA4 and YY1 are involved in the regulation of FcgammaRIIb expression, and that the expression variants of FcgammaRIIb lead to altered cell signaling, which may contribute to autoimmune pathogenesis in humans.
14984931 plays a transactivator role in the regulation of the transcription of the microsomal epoxide hydrolase gene (EPHX1)
14612389 in colorectal cancer and gastric cancer promoter hypermethylation and transcriptional silencing are frequent for GATA-4 and -5
14583613 GATA-4 is critical for transcription of the erythropoietin (Epo) gene in hepatocytes and may contribute to the switch in the site of Epo gene expression from the fetal liver to the adult kidney
12907682 Wild-type SF1 but not SF1 G35E is a potent transactvator in GAGA4-expressing cells. Results strengthen the importance of a GATA-4/SF-1 cooperation for MIS transcription; disruption of this synergism might lead to abnormal sex differentiation.
12845333 results implicate GATA4 as a genetic cause of human cardiac septal defects, perhaps through its interaction with TBX5
12775767 Nkx-2.5 and GATA-4 play prime roles in Dio2 gene regulation in the human heart and suggests that it is their synergistic action in humans that causes the differential expression of the cardiac Dio2 gene between humans and rats.
12606418 In postnatal ovary, granulosa cells of growing follicles express FOG-2, partially overlapping with expression of mullerian-inhibiting substance. Important role for FOG-2 and GATA transcription factors in developing ovary.
12606287 role in trans-activation of bone morphogenetic protein 4 and regulation of mammalian organogenesis
12530677 GATA-4 and GATA-6 mRNAs are readily detectable from gestational week 19 in human adrenal cortex.

AA Sequence

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGS      1 - 70
SGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAG     71 - 140
AGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDD    141 - 210
FSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTT    211 - 280
LWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNS    281 - 350
SNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT    351 - 420
SSKQDSWNSLVLADSHGDIITA                                                    421 - 442
//

Text Mined References (197)

PMID Year Title
26946174 2016 PKG-1? mediates GATA4 transcriptional activity.
26490736 2015 Hypermethylation of the GATA binding protein 4 (GATA4) promoter in Chinese pediatric acute myeloid leukemia.
26404840 2015 The DNA damage response induces inflammation and senescence by inhibiting autophagy of GATA4.
26381449 2015 The association of DNA methylation and brain volume in healthy individuals and schizophrenia patients.
26376067 2016 A novel mutation of GATA4 (K300T) associated with familial atrial septal defect.
26071180 2015 Gata4, Tbx5 and Baf60c induce differentiation of adipose tissue-derived mesenchymal stem cells into beating cardiomyocytes.
25928801 2015 c.620C>T mutation in GATA4 is associated with congenital heart disease in South India.
25873328 2015 GATA4 transgenic mice as an in vivo model of congenital heart disease.
25524324 2015 Germline mutations in NKX2-5, GATA4, and CRELD1 are rare in a Mexican sample of Down syndrome patients with endocardial cushion and septal heart defects.
25416133 2015 Stoichiometry of Gata4, Mef2c, and Tbx5 influences the efficiency and quality of induced cardiac myocyte reprogramming.
25272520 2014 [Mutations in the GATA4 gen in patients with non-syndromic congenital heart disease].
25099673 2014 A mutation in the Kozak sequence of GATA4 hampers translation in a family with atrial septal defects.
25053715 2015 Regulatory crosstalk between lineage-survival oncogenes KLF5, GATA4 and GATA6 cooperatively promotes gastric cancer development.
25025186 2014 Novel missense variants of ZFPM2/FOG2 identified in conotruncal heart defect patients do not impair interaction with GATA4.
25017055 2014 Prevalence and spectrum of GATA4 mutations associated with sporadic dilated cardiomyopathy.
24973415 2015 Epigenetic change (GATA-4 gene methylation) is associated with health status in chronic obstructive pulmonary disease.
24866383 2014 NEXN inhibits GATA4 and leads to atrial septal defects in mice and humans.
24862985 2014 GATA4 immunolocalization in breast carcinoma as a potent prognostic predictor.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24696446 2014 GATA4 mutations are a cause of neonatal and childhood-onset diabetes.
24687970 2014 HER2 and GATA4 are new prognostic factors for early-stage ovarian granulosa cell tumor-a long-term follow-up study.
24681789 Early cardiac gene transcript levels in peripheral blood mononuclear cells reflect severity in stable coronary artery disease.
24651021 2014 Importance of promoter methylation of GATA4 and TP53 genes in endometrioid carcinoma of endometrium.
24505034 2014 Gelsolin (GSN) induces cardiomyocyte hypertrophy and BNP expression via p38 signaling and GATA-4 transcriptional factor activation.
24498650 2014 A novel mutation of GATA4 (K319E) is responsible for familial atrial septal defect and pulmonary valve stenosis.
24416423 2014 FOXL2, GATA4, and SMAD3 co-operatively modulate gene expression, cell viability and apoptosis in ovarian granulosa cell tumor cells.
24415412 2014 GATA4 loss in the septum transversum mesenchyme promotes liver fibrosis in mice.
24366163 2014 A novel GATA4 loss-of-function mutation responsible for familial dilated cardiomyopathy.
24365599 2014 miR-200c and GATA binding protein 4 regulate human embryonic stem cell renewal and differentiation.
24330461 2013 A study of the role of GATA4 polymorphism in cardiovascular metabolic disorders.
24314346 2014 Genetic variation in the atrial natriuretic peptide transcription factor GATA4 modulates amygdala responsiveness in alcohol dependence.
24284823 2014 GATA factors promote ER integrity and ?-cell survival and contribute to type 1 diabetes risk.
24182332 2013 DNA methylation status of NKX2-5, GATA4 and HAND1 in patients with tetralogy of fallot.
24145767 2013 Importance of promoter methylation of GATA4 gene in epithelial ovarian cancer.
24089524 2013 Nicotine induces the up-regulation of the ?7-nicotinic receptor (?7-nAChR) in human squamous cell lung cancer cells via the Sp1/GATA protein pathway.
24083978 2013 Estrogen-related receptor gamma induces cardiac hypertrophy by activating GATA4.
24041700 2013 GATA4 loss-of-function mutation underlies familial dilated cardiomyopathy.
24000169 2013 GATA4 loss-of-function mutations underlie familial tetralogy of fallot.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
23746174 2013 Promoter methylation of GATA4, WIF1, NTRK1 and other selected tumour suppressor genes in ovarian cancer.
23745586 2013 Mutation p.S335X in GATA4 reduces its DNA binding affinity and enhances cell apoptosis associated with ventricular septal defect.
23626780 2013 Identification of functional mutations in GATA4 in patients with congenital heart disease.
23320456 2013 GATA4 and DcR1 methylation in glioblastomas.
23239811 2013 MYC-induced epigenetic activation of GATA4 in lung adenocarcinoma.
23215884 2012 Evaluation of the effect of genetic variations in GATA-4 on the phenprocoumon and acenocoumarol maintenance dose.
23138528 2013 Variants in GATA4 are a rare cause of familial and sporadic congenital diaphragmatic hernia.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
23029311 2012 GATA-4 and FOG-2 expression in pediatric ovarian sex cord-stromal tumors replicates embryonal gonadal phenotype: results from the TREP project.
22959235 Analyses of GATA4, NKX2.5, and TFAP2B genes in subjects from southern China with sporadic congenital heart disease.
22862823 2014 Association of GATA4 sequence variation with alcohol dependence.
22773876 2012 GATA-binding protein 4 (GATA-4) and T-cell acute leukemia 1 (TAL1) regulate myogenic differentiation and erythropoietin response via cross-talk with Sirtuin1 (Sirt1).
22648249 2012 Novel GATA4 mutations in patients with congenital ventricular septal defects.
22552926 2012 Mutation spectrum of the GATA4 gene in patients with idiopathic atrial fibrillation.
22500510 2012 Genetic analysis of the promoter region of the GATA4 gene in patients with ventricular septal defects.
22472323 2012 Epigenetic regulation of GATA4 expression by histone modification in AFP-producing gastric adenocarcinoma.
22101736 2012 A novel GATA4 loss-of-function mutation associated with congenital ventricular septal defect.
22043484 2011 Somatic mutations in NKX2–5, GATA4, and HAND1 are not a common cause of tetralogy of Fallot or hypoplastic left heart.
22018271 2011 Heterogeneity and degree of TIMP4, GATA4, SOX18, and EGFL7 gene promoter methylation in non-small cell lung cancer and surrounding tissues.
22011241 Combined mutation screening of NKX2-5, GATA4, and TBX5 in congenital heart disease: multiple heterozygosity and novel mutations.
21945496 2011 Look beyond one's own nose: combination of information from publicly available sources reveals an association of GATA4 polymorphisms with plasma triglycerides.
21933911 2011 Cardiac defects are infrequent findings in individuals with 8p23.1 genomic duplications containing GATA4.
21874226 2011 Novel GATA4 mutations in lone atrial fibrillation.
21834050 2011 Noncompaction of the left ventricular myocardium in a boy with a novel chromosome 8p23.1 deletion.
21815254 2011 Ebstein anomaly: Genetic heterogeneity and association with microdeletions 1p36 and 8p23.1.
21708142 2011 GATA4 loss-of-function mutations in familial atrial fibrillation.
21673957 2011 Investigation of association between PFO complicated by cryptogenic stroke and a common variant of the cardiac transcription factor GATA4.
21637914 2011 A novel GATA4 mutation responsible for congenital ventricular septal defects.
21631294 2011 GATA4 specific nonsynonymous single-nucleotide polymorphisms in congenital heart disease patients of Mysore, India.
21609320 2011 GATA-4 transcription factor regulates hepatic hepcidin expression.
21519287 2011 Investigation of somatic NKX2-5, GATA4 and HAND1 mutations in patients with tetralogy of Fallot.
21464220 2011 A GATA4-regulated tumor suppressor network represses formation of malignant human astrocytomas.
21373748 2011 Involvement of a novel GATA4 mutation in atrial septal defects.
21330551 2011 Transcription factor genes Smad4 and Gata4 cooperatively regulate cardiac valve development. [corrected]
21276881 Search of somatic GATA4 and NKX2.5 gene mutations in sporadic septal heart defects.
21220346 2011 Loss-of-function mutation in GATA4 causes anomalies of human testicular development.
21110066 2010 Mutations of the GATA4 and NKX2.5 genes in Chinese pediatric patients with non-familial congenital heart disease.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
21055141 2010 [Novel GATA4 mutations identified in patients with congenital atrial septal defects].
20931527 2010 [A novel GATA4 mutation leading to congenital ventricular septal defect].
20874241 2010 GATA4 mutations in 357 unrelated patients with congenital heart malformation.
20807224 2011 New mutations in ZFPM2/FOG2 gene in tetralogy of Fallot and double outlet right ventricle.
20659440 2010 A novel mutation of GATA4 in a familial atrial septal defect.
20654103 2010 [Genetic screening for novel GATA4 mutations associated with congenital atrial septal defect].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595226 2010 Wood smoke exposure and gene promoter methylation are associated with increased risk for COPD in smokers.
20592452 2010 Multiplex ligation-dependent probe amplification analysis of GATA4 gene copy number variations in patients with isolated congenital heart disease.
20585342 2011 Involvement of the atrial natriuretic peptide transcription factor GATA4 in alcohol dependence, relapse risk and treatment response to acamprosate.
20554787 2010 GATA4 protects granulosa cell tumors from TRAIL-induced apoptosis.
20450724 2010 [Novel GATA4 mutations identified in patients with congenital heart disease].
20363377 Mutations in the cardiac transcription factor GATA4 in patients with lone atrial fibrillation.
20347099 2010 A novel mutation in GATA4 gene associated with dominant inherited familial atrial septal defect.
20222162 2010 Methylation of GATA-4 and GATA-5 and development of sporadic gastric carcinomas.
20206639 2010 The transcription factor GATA-4 regulates cytochrome P4502C19 gene expression.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
20133952 2010 Cooperation between HNF-1alpha, Cdx2, and GATA-4 in initiating an enterocytic differentiation program in a normal human intestinal epithelial progenitor cell line.
20081228 2010 Cyclin-dependent kinase-9 is a component of the p300/GATA4 complex required for phenylephrine-induced hypertrophy in cardiomyocytes.
20041118 2009 Conserved usage of alternative 5' untranslated exons of the GATA4 gene.
19995889 2010 New insights into the regulation of CYP2C9 gene expression: the role of the transcription factor GATA-4.
19918328 2009 The developmental transcription factor Gata4 is overexpressed in pancreatic ductal adenocarcinoma.
19915893 2010 GATA4 mutations in Chinese patients with congenital cardiac septal defects.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19781215 2009 [Association between GATA-4 mutations and congenital cardiac septal defects in Han Chinese patients].
19678963 2009 Genetic screening of 104 patients with congenitally malformed hearts revealed a fresh mutation of GATA4 in those with atrial septal defects.
19666519 2009 GATA6 mutations cause human cardiac outflow tract defects by disrupting semaphorin-plexin signaling.
19649254 2009 Loss of GATA4 and GATA6 expression specifies ovarian cancer histological subtypes and precedes neoplastic transformation of ovarian surface epithelia.
19543315 2009 GATA4 is a regulator of astrocyte cell proliferation and apoptosis in the human and murine central nervous system.
19509152 2009 GATA4 and GATA5 are potential tumor suppressors and biomarkers in colorectal cancer.
19479054 2009 NKX2-5 regulates the expression of beta-catenin and GATA4 in ventricular myocytes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19353638 2009 A duplication including GATA4 does not co-segregate with congenital heart defects.
19353247 2009 Enhanced expression of transcription factor GATA-4 in inflammatory bowel disease and its possible regulation by TGF-beta1.
19302747 2009 GATA4 and NKX2.5 gene analysis in Chinese Uygur patients with congenital heart disease.
19276186 2009 A negative feedback regulatory loop associates the tyrosine kinase receptor ERBB2 and the transcription factor GATA4 in breast cancer cells.
19018306 2008 Investigation between the S377G3 GATA-4 polymorphism and migraine.
19008335 2009 The effect of human GATA4 gene mutations on the activity of target gonadal promoters.
18983250 Cardiac differentiation is driven by NKX2.5 and GATA4 nuclear translocation in tissue-specific mesenchymal stem cells.
18672102 GATA4 mutations in 486 Chinese patients with congenital heart disease.
18653721 2008 GATA-4 regulates Bcl-2 expression in ovarian granulosa cell tumors.
18426912 2008 Hepatocyte nuclear factor 4alpha contributes to thyroid hormone homeostasis by cooperatively regulating the type 1 iodothyronine deiodinase gene with GATA4 and Kruppel-like transcription factor 9.
18405344 2008 Transcription factors GATA-4 and GATA-6 in normal and neoplastic human gastrointestinal mucosa.
18227727 2008 GATA-4 and GATA-6 expression in human ovarian surface epithelial carcinoma.
18076106 2008 Mutations in GATA4, NKX2.5, CRELD1, and BMP4 are infrequently found in patients with congenital cardiac septal defects.
18055909 2007 GATA4 sequence variants in patients with congenital heart disease.
17912029 2007 Evaluation of GATA-4 and GATA-5 methylation profiles in human pancreatic cancers indicate promoter methylation patterns distinct from other human tumor types.
17848411 2007 Developmental changes in human fetal testicular cell numbers and messenger ribonucleic acid levels during the second trimester.
17805225 2008 Identification of a chromosome 8p locus for early-onset coronary heart disease in a French Canadian population.
17643447 2007 Spectrum of heart disease associated with murine and human GATA4 mutation.
17592645 2007 Mutations in the 3'-untranslated region of GATA4 as molecular hotspots for congenital heart disease (CHD).
17584735 2007 Transcriptional repression by the T-box proteins Tbx18 and Tbx15 depends on Groucho corepressors.
17548362 2007 Analysis of the signals and mechanisms mediating nuclear trafficking of GATA-4. Loss of DNA binding is associated with localization in intranuclear speckles.
17403900 2007 Cooperative interaction between hepatocyte nuclear factor 4 alpha and GATA transcription factors regulates ATP-binding cassette sterol transporters ABCG5 and ABCG8.
17352393 2007 Screening and biochemical analysis of GATA4 sequence variations identified in patients with congenital heart disease.
17290010 2007 Cooperation between GATA4 and TGF-beta signaling regulates intestinal epithelial gene expression.
17253934 2006 Screening of 99 Danish patients with congenital heart disease for GATA4 mutations.
17211834 2007 Oct-4, Rex-1, and Gata-4 expression in human MSC increase the differentiation efficiency but not hTERT expression.
17053787 2006 The Kruppel-like transcription factor KLF13 is a novel regulator of heart development.
16823849 2006 Hypermethylation of the GATA gene family in esophageal cancer.
16607277 2006 Histone modifications silence the GATA transcription factor genes in ovarian cancer.
16604480 2006 Two novel missense mutations of GATA4 gene in Chinese patients with sporadic congenital heart defects.
16470721 2006 A novel mutation in the GATA4 gene in patients with Tetralogy of Fallot.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16337738 2006 Involvement of GATA-4/-5 transcription factors in ovarian carcinogenesis.
16199874 2005 Hey basic helix-loop-helix transcription factors are repressors of GATA4 and GATA6 and restrict expression of the GATA target gene ANF in fetal hearts.
16159935 2005 High GATA-4 expression associates with aggressive behavior, whereas low anti-Müllerian hormone expression associates with growth potential of ovarian granulosa cell tumors.
16137232 2005 GATA factors lie upstream of Nkx 2.5 in the transcriptional regulatory cascade that effects cardiogenesis.
16110260 Transcription factors GATA-4 and GATA-6, and their potential downstream effectors in ovarian germ cell tumors.
15810002 2005 Phenotypes with GATA4 or NKX2.5 mutations in familial atrial septal defect.
15734735 2005 Regulation of sphingosine-1-phosphate lyase gene expression by members of the GATA family of transcription factors.
15666845 2004 Transcription factors GATA-4 and GATA-6 in human adrenocortical tumors.
15653675 2005 CSX/Nkx2.5 modulates differentiation of skeletal myoblasts and promotes differentiation into neuronal cells in vitro.
15585625 2004 Hypermethylation of the GATA genes in lung cancer.
15542826 2004 Jumonji represses atrial natriuretic factor gene expression by inhibiting transcriptional activities of cardiac transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485867 2004 Hairy-related transcription factors inhibit GATA-dependent cardiac gene expression through a signal-responsive mechanism.
15389642 2005 Differential expression of claudin-2 along the human intestine: Implication of GATA-4 in the maintenance of claudin-2 in differentiating cells.
15337742 2004 SUMO-1 modification activated GATA4-dependent cardiogenic gene activity.
15235040 2004 A novel GATA4 mutation completely segregated with atrial septal defect in a large Japanese family.
15153544 2004 A promoter haplotype of the immunoreceptor tyrosine-based inhibitory motif-bearing FcgammaRIIb alters receptor expression and associates with autoimmunity. II. Differential binding of GATA4 and Yin-Yang1 transcription factors and correlated receptor expression and function.
14984931 2004 Regulation of human microsomal epoxide hydrolase gene (EPHX1) expression by the transcription factor GATA-4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612389 2003 GATA-4 and GATA-5 transcription factor genes and potential downstream antitumor target genes are epigenetically silenced in colorectal and gastric cancer.
14583613 2004 Hepatic erythropoietin gene regulation by GATA-4.
12907682 2003 A mutated form of steroidogenic factor 1 (SF-1 G35E) that causes sex reversal in humans fails to synergize with transcription factor GATA-4.
12845333 2003 GATA4 mutations cause human congenital heart defects and reveal an interaction with TBX5.
12775767 2003 The different cardiac expression of the type 2 iodothyronine deiodinase gene between human and rat is related to the differential response of the Dio2 genes to Nkx-2.5 and GATA-4 transcription factors.
12606418 2003 FOG-2 and GATA-4 Are coexpressed in the mouse ovary and can modulate mullerian-inhibiting substance expression.
12606287 2003 Transcriptional activation of BMP-4 and regulation of mammalian organogenesis by GATA-4 and -6.
12530967 2003 Cysteine-rich LIM-only proteins CRP1 and CRP2 are potent smooth muscle differentiation cofactors.
12530677 2002 Transcription factors GATA-4 and GATA-6 during mouse and human adrenocortical development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11994297 2002 The transcription factors GATA4 and dHAND physically interact to synergistically activate cardiac gene expression through a p300-dependent mechanism.
11724781 2002 Defects of the heart, eye, and megakaryocytes in peroxisome proliferator activator receptor-binding protein (PBP) null embryos implicate GATA family of transcription factors.
11585926 2001 The transcription factor GATA4 is activated by extracellular signal-regulated kinase 1- and 2-mediated phosphorylation of serine 105 in cardiomyocytes.
11481322 2001 p300 Functions as a coactivator of transcription factor GATA-4.
11297508 2001 Proper coronary vascular development and heart morphogenesis depend on interaction of GATA-4 with FOG cofactors.
11158291 2001 Serum response factor-GATA ternary complex required for nuclear signaling by a G-protein-coupled receptor.
11003651 2000 Cardiac tissue enriched factors serum response factor and GATA-4 are mutual coregulators.
10948187 2000 Functional analyses of three Csx/Nkx-2.5 mutations that cause human congenital heart disease.
10790371 2000 GATA-dependent recruitment of MEF2 proteins to target promoters.
10728696 2000 A minimal critical region of the 8p22-23 amplicon in esophageal adenocarcinomas defined using sequence tagged site-amplification mapping and quantitative polymerase chain reaction includes the GATA-4 gene.
10446911 1999 Transcription factor GATA-4 enhances Müllerian inhibiting substance gene transcription through a direct interaction with the nuclear receptor SF-1.
9927675 1999 Molecular cloning of FOG-2: a modulator of transcription factor GATA-4 in cardiomyocytes.
9858576 1999 Identification of the in vivo casein kinase II phosphorylation site within the homeodomain of the cardiac tisue-specifying homeobox gene product Csx/Nkx2.5.
9857019 1998 Myocyte enhancer factor 2C and Nkx2-5 up-regulate each other's expression and initiate cardiomyogenesis in P19 cells.
9568714 1998 A calcineurin-dependent transcriptional pathway for cardiac hypertrophy.
9566909 1998 Distinct functions are implicated for the GATA-4, -5, and -6 transcription factors in the regulation of intestine epithelial cell differentiation.
9312027 1997 The cardiac transcription factors Nkx2-5 and GATA-4 are mutual cofactors.
9207128 1997 Angiotensin II type1a receptor gene expression in the heart: AP-1 and GATA-4 participate in the response to pressure overload.
8978781 1996 Assignment of the human GATA4 gene to 8p23.1-->p22 using fluorescence in situ hybridization analysis.
8455608 1993 Mouse GATA-4: a retinoic acid-inducible GATA-binding transcription factor expressed in endodermally derived tissues and heart.
8007990 1994 Transcription factor GATA-4 regulates cardiac muscle-specific expression of the alpha-myosin heavy-chain gene.
7791790 1995 Of the GATA-binding proteins, only GATA-4 selectively regulates the human interleukin-5 gene promoter in interleukin-5-producing cells which express multiple GATA-binding proteins.
7721094 1995 Identification of a GATA motif in the cardiac alpha-myosin heavy-chain-encoding gene and isolation of a human GATA-4 cDNA.
7665171 1995 Assignment of the transcription factor GATA4 gene to human chromosome 8 and mouse chromosome 14: Gata4 is a candidate gene for Ds (disorganization).
3413070 1988 An erythrocyte-specific DNA-binding factor recognizes a regulatory sequence common to all chicken globin genes.