Property Summary

NCBI Gene PubMed Count 316
PubMed Score 1568.19
PubTator Score 575.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hodgkin's lymphoma 15 0.0 2.9
Leukemia 104 0.0 0.8

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
Breast cancer 1.200 3.9e-02
breast carcinoma 1.800 7.8e-05
cutaneous lupus erythematosus -1.800 3.6e-05
ductal carcinoma in situ 2.800 1.1e-02
fibroadenoma 1.700 7.3e-03
glioblastoma 1.500 9.3e-05
interstitial cystitis -3.000 4.8e-03
intraductal papillary-mucinous adenoma (... 1.400 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.1e-02
invasive ductal carcinoma 3.500 7.1e-03
lung cancer 1.700 2.0e-02
malignant mesothelioma 1.200 2.8e-05
nephrosclerosis 1.135 5.7e-03
osteosarcoma -1.545 1.5e-03
pancreatic cancer 1.200 3.7e-03
pituitary cancer 3.600 4.4e-05
primitive neuroectodermal tumor 2.300 3.6e-02
psoriasis -1.600 1.1e-07

Protein-protein Interaction (2)

Gene RIF (286)

AA Sequence

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA      1 - 70
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS     71 - 140
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG    141 - 210
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTG    211 - 280
HYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI    281 - 350
NRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT    351 - 420
PMHPPSSLSFGPHHPSSMVTAMG                                                   421 - 443
//

Text Mined References (321)

PMID Year Title