Property Summary

NCBI Gene PubMed Count 18
PubMed Score 46.14
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (6)

PMID Text
26358320 Taken together, our results demonstrated the deregulation of GAS2 in both AML and ALL and the requirement of GAS2-Calpain2 axis for the growth of leukemic cells.
25925944 Truncated HBx deregulates cell growth via direct silencing of GAS2 and thereby provides a survival advantage for pre-neoplastic hepatocytes to facilitate cancer development via TP53 signaling.
24465953 GAS2 is up-regulated in chronic myeloid leukemia cells.
20679491 Studies have identified a Gas2/calpain-dependent mechanism by which ICSBP influences beta-catenin activity in myeloid leukemia.
20677014 Observational study of gene-disease association. (HuGE Navigator)
15817486 Gas2DN can increase the activity of calpain and induce degradation of stabilized/mutated beta-catenin

AA Sequence

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL      1 - 70
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK     71 - 140
QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS    141 - 210
EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK    211 - 280
TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK                                         281 - 313
//

Text Mined References (22)

PMID Year Title
26358320 2015 GAS2-Calpain2 axis contributes to the growth of leukemic cells.
25925944 2015 Truncated HBx-dependent silencing of GAS2 promotes hepatocarcinogenesis through deregulation of cell cycle, senescence and p53-mediated apoptosis.
24465953 2014 Growth arrest specific 2 is up-regulated in chronic myeloid leukemia cells and required for their growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20679491 2010 Interferon consensus sequence binding protein (ICSBP) decreases beta-catenin activity in myeloid cells by repressing GAS2 transcription.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15817486 2005 The calpain system is involved in the constitutive regulation of beta-catenin signaling functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15124103 2004 The novel gene encoding a putative transmembrane protein is mutated in gnathodiaphyseal dysplasia (GDD).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11387205 2001 The death substrate Gas2 binds m-calpain and increases susceptibility to p53-dependent apoptosis.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10564664 1999 Caspase-3 and caspase-7 but not caspase-6 cleave Gas2 in vitro: implications for microfilament reorganization during apoptosis.
9521882 1998 cDNA characterization and chromosome mapping of the human GAS2 gene.
3409319 1988 Genes specifically expressed at growth arrest of mammalian cells.
1607387 1992 Gas2, a growth arrest-specific protein, is a component of the microfilament network system.
1056466 1975 Antibiotic treatment of oral anaerobic infections.