Property Summary

NCBI Gene PubMed Count 49
PubMed Score 412.84
PubTator Score 94.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.070 1.6e-08
lung cancer 1.100 6.2e-04
Multiple myeloma 1.690 5.4e-04
non-small cell lung cancer 1.228 6.2e-27
ovarian cancer 2.800 4.0e-08

PDB (14)

Gene RIF (30)

AA Sequence

MPSPRPVLLRGARAALLLLLPPRLLARPSLLLRRSLSAASCPPISLPAAASRSSMDGAGAEEVLAPLRLA      1 - 70
VRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAI     71 - 140
YGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGE    141 - 210
CFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNL    211 - 280
MFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAE    281 - 350
IEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKV    351 - 420
GISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPK    421 - 490
TVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKR    491 - 560
FQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPF    561 - 630
VKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEIS    631 - 700
ELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE                                   701 - 739
//

Text Mined References (59)

PMID Year Title