Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.19
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 2.7e-08
Astrocytoma, Pilocytic -1.500 6.7e-12
atypical teratoid / rhabdoid tumor -1.300 5.1e-05
ependymoma -1.500 7.7e-16
glioblastoma -1.700 3.9e-11
group 4 medulloblastoma -1.100 3.2e-05
interstitial cystitis -1.200 2.5e-03
medulloblastoma, large-cell -1.300 3.4e-05
Pick disease -1.300 7.2e-04
pituitary cancer 2.000 6.2e-06
subependymal giant cell astrocytoma -2.025 8.1e-03
urothelial carcinoma -1.100 2.3e-02

Gene RIF (2)

AA Sequence

MVVDFCRRFVARSLCIILMKHFCSSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGS      1 - 70
SDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRA     71 - 140
ILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFA    141 - 210
KDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVST    211 - 280
MLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSPAFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEE    281 - 350
SVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNML    351 - 420
NRRSFSDVLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPH    421 - 490
EAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSA    491 - 560
LQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLL    561 - 630
SPLSESPVEEFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVN    631 - 700
FVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDS    701 - 770
MEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTPPGRDTPVFPSSL    771 - 840
GEGEIQSKNLYKIPLRNLVGRSIERPLKSPLVSKVITPPTPISVGLAAIPVTHSLSLSRMEIKEIASRTR    841 - 910
RELLGLSDEGGPKSEGAPKAKSKPRKRLEESQGGPKPGAVRSSSSDRIPSGSLESASTSEANPEGHSASS    911 - 980
DQDPVADREGSPVSGSSPFQLTAFSDEDIIDLK                                         981 - 1013
//

Text Mined References (10)

PMID Year Title