Property Summary

NCBI Gene PubMed Count 55
PubMed Score 732.18
PubTator Score 565.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (22)

PMID Text
26071889 The peripheral neuropathies lead to an initial increase in GAP-43 gene expression as a potential mechanism of regeneration, which is not sustained in neuropathies of long duration.
25755278 Results show that PKC-dependent phosphorylation of GAP43 plays a critical role in regulating postsynaptic gephyrin aggregation in developing GABAergic synapses.
24301786 increased expression of TH and GAP43 might be a molecular mechanism for left atrial myoelectricity remodeling of aging atrial fibrillation patients, which might be potential therapeutic targets of atrial fibrillation.
23887302 GAP43 is seemingly a highly sensitive marker for peripheral nerve sheath tumors
23524246 The results showed that the decreased GAP-43 levels induced by glutamate could be partially reversed by the presence of NRG-1beta
23396970 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43
23153097 immunostaning for GAP-43 was relatively similar in ganglionic versus aganglionic colon.
22209024 Impaired regeneration of intra-epidermal C fibers in the early stages of type 2 diabetes mellitus, as indicated by GAP-43 expression, might be a marker of incipient diabetic neuropathy.
22138049 The results of this study supported to the hypothesis of multiple rare mutations in schizophrenia, and it provides genetic clues that indicate the involvement of GAP-43 in this disorder.
22082156 Knockdown of growth associated protein 43 (GAP43) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21769916 Through MEK/ERK pathway, S1P stimulates GAP43 transcription with increased binding of C/EBPbeta to the 5'-promoter
21152083 Results demonstrate that APT-2 is the protein thioesterase involved in the acylation/deacylation cycle operating in GAP-43 subcellular distribution.
20869470 Results indicate that there is no strong and direct interaction between POP and GAP43 at physiological conditions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19593683 Around 1 month post lesion, degeneration at the cochlear nuclei progressively disappeared and a relevant GAP-43 expression was found.
17619016 Data show that functional cooperation between TrkA and p75(NTR) accelerates neuronal differentiation by increased transcription of GAP-43 and p21(CIP/WAF) genes via ERK1/2 and AP-1 activities.
17577668 HuD plays a role in the post-transcriptional control of GAP-43 mRNA
17412328 Growth-associated protein 43, a marker of neural outgrowth and regeneration, is expressed in endometriosis-associated nerve fibers but not in existing peritoneal nerves.
15694236 Schizophrenia had significant decreases in GAP-43 immunoreactivity in the hilus (p<0.05, paired t-test) and inner molecular layer (p<0.05, paired t-test) but not in the outer molecular layer. In the same tissues.
12805215 Data show that GAP43 acts as an osmosensory protein that augments internal calcium in response to hypotonicity.
12704705 In the dermis, there were fewer GAP-43 nerve fibers than PGP 9.5 fibers, whereas in the epidermis the numbers were equal. Only some Merkel cells and Meissner corpuscles were GAP-43-immunoreactive.
12105219 chemical analysis of fatty acylated species in GAP43

AA Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD      1 - 70
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET     71 - 140
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE    141 - 210
AVDETKPKESARQDEGKEEEPEADQEHA                                              211 - 238
//

Text Mined References (57)

PMID Year Title
26071889 2015 Increased gene expression of growth associated protein-43 in skin of patients with early-stage peripheral neuropathies.
25755278 2015 Protein kinase C-dependent growth-associated protein 43 phosphorylation regulates gephyrin aggregation at developing GABAergic synapses.
24301786 2013 Expression of tyrosine hydroxylase and growth-associated protein 43 in aging atrial fibrillation patients of Xinjiang Uygur and Han nationality.
23887302 2014 Growth-associated protein 43 in differentiating peripheral nerve sheath tumors from other non-neural spindle cell neoplasms.
23524246 Effects of neuregulin-1? on growth-associated protein 43 expression in dorsal root ganglion neurons with excitotoxicity induced by glutamate in vitro.
23396970 2013 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43.
23153097 Growth-associated protein 43 expression in ganglionic and aganglionic colon.
22209024 2012 Expression of growth-associated protein 43 in the skin nerve fibers of patients with type 2 diabetes mellitus.
22138049 2012 Genetic and functional analysis of the gene encoding GAP-43 in schizophrenia.
21769916 2011 Sphingosine kinase 1/S1P pathway involvement in the GDNF-induced GAP43 transcription.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21152083 2010 Acyl-protein thioesterase 2 catalyzes the deacylation of peripheral membrane-associated GAP-43.
20869470 2010 GAP43 shows partial co-localisation but no strong physical interaction with prolyl oligopeptidase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19593683 2010 Cellular and molecular bases of neuroplasticity: brainstem effects after cochlear damage.
17619016 2007 Functional cooperation between TrkA and p75(NTR) accelerates neuronal differentiation by increased transcription of GAP-43 and p21(CIP/WAF) genes via ERK1/2 and AP-1 activities.
17577668 2007 Coordinated expression of HuD and GAP-43 in hippocampal dentate granule cells during developmental and adult plasticity.
17412328 2007 Growth-associated protein 43-positive sensory nerve fibers accompanied by immature vessels are located in or near peritoneal endometriotic lesions.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15694236 2005 Growth-associated protein 43 (GAP-43) and synaptophysin alterations in the dentate gyrus of patients with schizophrenia.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14978216 2004 Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12898703 2003 Cytokine, chemokine and growth factor gene profiling of cultured human astrocytes after exposure to proinflammatory stimuli.
12805215 2003 GAP43 stimulates inositol trisphosphate-mediated calcium release in response to hypotonicity.
12704705 2003 Distribution of GAP-43 nerve fibers in the skin of the adult human hand.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105219 2002 Mass spectrometric analysis of GAP-43/neuromodulin reveals the presence of a variety of fatty acylated species.
12034726 2002 Poly(A) tail length-dependent stabilization of GAP-43 mRNA by the RNA-binding protein HuD.
11978831 2002 GAP-43 is critical for normal development of the serotonergic innervation in forebrain.
11528129 2001 Integration of porcine chromosome 13 maps.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11238933 2001 Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10544214 1999 Quantitative comparison of growth-associated protein GAP-43, neuron-specific enolase, and protein gene product 9.5 as neuronal markers in mature human intestine.
10521589 1999 Can GAP-43 interact with brain spectrin?
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9881859 1998 Hippocampal and cortical growth-associated protein-43 messenger RNA in schizophrenia.
9774477 1998 Association of GAP-43 with detergent-resistant membranes requires two palmitoylated cysteine residues.
9742146 1998 The neuronal growth-associated protein GAP-43 interacts with rabaptin-5 and participates in endocytosis.
9618702 1998 Subcellular localization of phosphoprotein B-50 in regenerating muscle. An immuno-electron microscopic study.
9139733 1997 Regulated binding of the protein kinase C substrate GAP-43 to the V0/C2 region of protein kinase C-delta.
8900147 1996 Analysis of the role of calmodulin binding and sequestration in neuromodulin (GAP-43) function.
8746449 1995 Cloning and promoter analysis of the human B-50/GAP-43 gene.
8737678 1996 GAP-43 mRNA expression in early development of human nervous system.
8694767 1996 Phosphorylation of GAP-43 (growth-associated protein of 43 kDa) by conventional, novel and atypical isotypes of the protein kinase C gene family: differences between oligopeptide and polypeptide phosphorylation.
8231732 1993 Structure of the human gene for the neural phosphoprotein B-50 (GAP-43).
3272163 1988 Cloning of human GAP-43: growth association and ischemic resurgence.
3272162 1988 Human GAP-43: its deduced amino acid sequence and chromosomal localization in mouse and human.
2140056 1990 Identification of the protein kinase C phosphorylation site in neuromodulin.
1828073 1991 Phosphorylation of neuromodulin (GAP-43) by casein kinase II. Identification of phosphorylation sites and regulation by calmodulin.
1533624 1992 GAP-43, a protein associated with axon growth, is phosphorylated at three sites in cultured neurons and rat brain.
1385623 1992 Immunocytochemical detection of the growth-associated protein B-50 by newly characterized monoclonal antibodies in human brain and muscle.
1281863 1992 Expression of growth-associated protein 43 and nerve growth factor receptor in human skin: a comparative immunohistochemical investigation.