Property Summary

Ligand Count 2
NCBI Gene PubMed Count 31
PubMed Score 84.42
PubTator Score 3.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.500 4.5e-03
Astrocytoma, Pilocytic 1.200 3.1e-05
atypical teratoid / rhabdoid tumor 1.400 2.0e-10
diabetes mellitus -1.300 8.4e-03
ependymoma 1.300 6.0e-03
glioblastoma 1.200 9.7e-08
group 4 medulloblastoma 1.200 4.8e-04
lung adenocarcinoma 1.100 1.1e-10
lung cancer 1.800 6.7e-05
medulloblastoma, large-cell 1.600 5.8e-05
oligodendroglioma 1.100 5.3e-03
osteosarcoma 1.407 1.1e-04
pediatric high grade glioma 1.500 6.0e-07
psoriasis -2.300 1.8e-05

Protein-protein Interaction (10)

Gene RIF (36)

AA Sequence

MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLG      1 - 70
PDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVEL     71 - 140
TMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDK    141 - 210
PEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLY    211 - 280
NLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQ    281 - 350
TDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN    351 - 420
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYV    421 - 490
KTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDA    491 - 560
QHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISI    561 - 630
PMCLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDA    631 - 700
LGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLP    701 - 770
GQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA    771 - 840
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGS    841 - 910
PESRLSFQHDPETSVLVLRKPGINVASDWSIHLR                                        911 - 944
//

Text Mined References (36)

PMID Year Title