Property Summary

Ligand Count 22
NCBI Gene PubMed Count 31
PubMed Score 70.37
PubTator Score 51.16

Knowledge Summary

Patent (21,876)


  Disease (4)


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 5.8e-15

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

ALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA                                     351 - 387

Text Mined References (31)

PMID Year Title