Property Summary

Ligand Count 30
NCBI Gene PubMed Count 38
PubMed Score 106.84
PubTator Score 62.79

Knowledge Summary

Patent (5,661)

TINX Plot

  Disease (6)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 2.9e-03
Astrocytoma, Pilocytic 1.800 9.2e-06
glioblastoma 1.500 5.7e-04
psoriasis -1.100 9.5e-17

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTT      1 - 70
NLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHS     71 - 140
RRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFCWEQWPDPRHKKAYVVCTFVFGYL    141 - 210
LPLLLICFCYAKVLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPA    211 - 280
SFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV     281 - 349
//

Text Mined References (40)

PMID Year Title