Property Summary

NCBI Gene PubMed Count 36
PubMed Score 105.60
PubTator Score 62.79

Knowledge Summary

Patent (5,661)

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.500 5.7e-04
pediatric high grade glioma 1.600 9.1e-03
pilocytic astrocytoma 1.900 7.5e-06
psoriasis -1.100 9.5e-17

Gene RIF (22)

PMID Text
26572146 GAL and its receptors, GALR1 and GALR2, play a role in head and neck squamous cell carcinoma tumorigenesis
24706871 Variants in genes for galanin (GAL) and its receptors (GALR1, GALR2, GALR3), despite their disparate genomic loci, conferred increased risk of depression and anxiety in people who experienced childhood adversity or recent negative life events.
23727823 GALR1 methylation is associated with endometrial cancer.
22859720 Moreover, we have identified a novel role for the GalR1/galanin receptor-ligand axis in chemoresistance, providing evidence to support its further evaluation as a potential therapeutic target and biomarker in colorectal cancer .
21796100 Genetic variants in the GALR1 gene are associated with a protective effect in nicotine dependence.
21430647 The results of this study suggested an association between variation at the GALR1 locus and baseline craving for tobacco in smokers seeking cessation treatment.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20171159 it has been demonstrated that GalR1-5-HT1A receptors heteromerize.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19047085 GALR1 is a tumor suppressor gene in head and neck squamous cell carcinoma
18973137 GAL, coding for the neuropeptide galanin, and GALR1, a galanin receptor, were identified as candidate genes of oncogenesis in squamous cell carcinoma using a survey of parallel chromosomal alterations and gene expression studies in 10 SCC cell lines.
18385373 GalR1 is internalized via the clathrin-dependent, endocytic pathway and then, to a large extent, delivered to lysosomes for degradation through the lysosome-targeting signal YXXO
17982695 Data suggest that galanin stimulates cortisol secretion from human inner adrenocortical cells, acting through GAL-R1 coupled to the adenylate cyclase/PKA-dependent signaling cascade via a Ptx-sensitive Galpha protein.
17083333 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17083333 There was no effect of GALR1 on alcoholism risk.
15930442 Observational study of gene-disease association. (HuGE Navigator)
15930442 The analyzed single nucleotide polymorphisms in GAL and GALR1 do not play major role in early onset obesity or dietary fat intake in obese children and adolescents.
15767248 disregulation of galanin receptor 1 may lead to uncontrolled proliferation and neoplastic transformation

AA Sequence

MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTT      1 - 70
NLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHS     71 - 140
RRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFCWEQWPDPRHKKAYVVCTFVFGYL    141 - 210
LPLLLICFCYAKVLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPA    211 - 280
SFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV     281 - 349
//

Text Mined References (38)

PMID Year Title
26572146 2016 Epigenetic inactivation of galanin and GALR1/2 is associated with early recurrence in head and neck cancer.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
24706871 2014 Brain galanin system genes interact with life stresses in depression-related phenotypes.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
23727823 2013 GALR1 methylation in vaginal swabs is highly accurate in identifying women with endometrial cancer.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22859720 2012 Identification of galanin and its receptor GalR1 as novel determinants of resistance to chemotherapy and potential biomarkers in colorectal cancer.
21796100 2011 The neuropeptide galanin and variants in the GalR1 gene are associated with nicotine dependence.
21430647 2011 The galanin receptor 1 gene associates with tobacco craving in smokers seeking cessation treatment.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20171159 2010 Galanin receptor-1 modulates 5-hydroxtryptamine-1A signaling via heterodimerization.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19047085 2008 Epigenetic inactivation of galanin receptor 1 in head and neck cancer.
18973137 2009 The galanin signaling cascade is a candidate pathway regulating oncogenesis in human squamous cell carcinoma.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18385373 2008 Postendocytotic traffic of the galanin R1 receptor: a lysosomal signal motif on the cytoplasmic terminus.
17982695 2007 Galanin stimulates cortisol secretion from human adrenocortical cells through the activation of galanin receptor subtype 1 coupled to the adenylate cyclase-dependent signaling cascade.
17083333 2007 Alcoholism is associated with GALR3 but not two other galanin receptor genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15930442 2005 Human galanin (GAL) and galanin 1 receptor (GALR1) variations are not involved in fat intake and early onset obesity.
15767248 2005 Galanin receptor 1 has anti-proliferative effects in oral squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9808667 1998 Pharmacological and biochemical characterization of a recombinant human galanin GALR1 receptor: agonist character of chimeric galanin peptides.
9425310 1997 Cloning, chromosomal location, and transcriptional regulation of the human galanin-1 receptor gene (GALN1R).
9367674 1997 Structural organization of the mouse and human GALR1 galanin receptor genes (Galnr and GALNR) and chromosomal localization of the mouse gene.
9168941 1997 Pharmacological characterization and tissue distribution of the human and rat GALR1 receptors.
8825658 1995 Assignment of the gene encoding human galanin receptor (GALNR) to 18q23 by in situ hybridization.
8670213 1996 Cloning and quantification of galanin-1 receptor expression by mucosal cells lining the human gastrointestinal tract.
8617199 1996 Delineation of the peptide binding site of the human galanin receptor.
7534460 1994 Identification and biochemical characterization of the human brain galanin receptor.
7524088 1994 Molecular cloning of a functional human galanin receptor.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.