Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.96
PubTator Score 8.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (7)

AA Sequence

MRLKIGFILRSLLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVV      1 - 70
PWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEP     71 - 140
EPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSS    141 - 210
VVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGL    211 - 280
IQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDG    281 - 350
YARGAWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEIS    351 - 420
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYFYASRPESQAL    421 - 490
PYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGFETAYCIDSMGKTNGGFVELG    491 - 560
PCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSE    561 - 630
VLHQVFISNCDSSKTTQKWEMNNIHSV                                               631 - 657
//

Text Mined References (17)

PMID Year Title