Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.00
PubTator Score 10.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.687 6.5e-03
active ulcerative colitis 2.812 6.3e-03
Atopic dermatitis 1.600 1.3e-03
Barrett's esophagus 2.700 1.7e-02
Breast cancer 1.100 1.0e-02
breast carcinoma 1.100 2.4e-04
chronic rhinosinusitis 1.281 1.2e-02
colon cancer 2.200 4.5e-02
cutaneous lupus erythematosus 1.200 5.6e-03
cystic fibrosis 1.465 5.2e-05
ductal carcinoma in situ 2.800 8.5e-03
esophageal adenocarcinoma 2.000 1.9e-02
facioscapulohumeral dystrophy 3.300 1.2e-13
fibroadenoma 1.400 6.6e-04
interstitial cystitis 1.200 5.4e-04
intraductal papillary-mucinous adenoma (... 3.900 3.4e-06
intraductal papillary-mucinous carcinoma... 2.200 2.1e-03
intraductal papillary-mucinous neoplasm ... 2.000 3.3e-03
invasive ductal carcinoma 3.100 1.0e-02
lung adenocarcinoma 1.300 1.8e-04
lung cancer -1.100 9.2e-03
malignant mesothelioma -1.900 7.5e-06
osteosarcoma -3.087 2.2e-06
ovarian cancer 1.200 1.2e-07
pancreatic cancer 1.300 1.3e-04
pituitary cancer -1.100 8.9e-05
psoriasis 2.200 3.7e-08

Gene RIF (11)

AA Sequence

MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEAMNNLRDSMPK      1 - 70
LQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKH     71 - 140
CFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLK    141 - 210
EIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLE    211 - 280
PLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIK    281 - 350
SPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG    351 - 420
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFV    421 - 490
PDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGA    491 - 560
LGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV            561 - 622
//

Text Mined References (19)

PMID Year Title