Property Summary

NCBI Gene PubMed Count 77
PubMed Score 31.15
PubTator Score 44.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.067 3.4e-03
active ulcerative colitis 1.191 1.5e-02
astrocytoma 2.600 5.4e-04
Astrocytoma, Pilocytic 1.300 1.4e-04
atypical teratoid / rhabdoid tumor 1.700 6.6e-04
Breast cancer 1.200 2.0e-07
breast carcinoma 1.100 5.0e-19
diabetes mellitus -1.100 1.6e-02
ependymoma 1.400 1.4e-02
gastric carcinoma 1.400 1.2e-02
glioblastoma 1.200 4.6e-04
intraductal papillary-mucinous adenoma (... -1.400 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.7e-02
lung adenocarcinoma 1.059 4.1e-04
lung cancer 1.900 2.7e-03
malignant mesothelioma -1.600 4.5e-07
Multiple myeloma 1.525 3.5e-03
non-small cell lung cancer 1.514 2.7e-16
oligodendroglioma 1.100 1.1e-02
osteosarcoma -1.164 4.4e-03
ovarian cancer 2.700 3.8e-06
pancreatic ductal adenocarcinoma liver m... -2.016 5.6e-03
pediatric high grade glioma 1.800 8.0e-05
Waldenstrons macroglobulinemia 1.180 1.5e-02

Gene RIF (46)

AA Sequence

MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMET      1 - 70
LPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSV     71 - 140
VITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVR    141 - 210
GADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVF    211 - 280
KWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLE    281 - 350
IIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKK    351 - 420
LSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSV    421 - 490
KHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALS    491 - 560
QQWKFTLNLQQ                                                               561 - 571
//

Text Mined References (81)

PMID Year Title