Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.72
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 7.3e-03
astrocytic glioma -1.400 2.0e-02
Atopic dermatitis -1.100 2.6e-02
atypical teratoid / rhabdoid tumor -1.200 7.5e-03
breast carcinoma -1.500 9.8e-20
cystic fibrosis -1.415 4.1e-06
ductal carcinoma in situ -1.600 1.4e-03
glioblastoma -1.100 2.0e-04
group 3 medulloblastoma -1.600 1.4e-04
inflammatory breast cancer -2.300 7.4e-03
intraductal papillary-mucinous adenoma (... -2.300 1.4e-04
intraductal papillary-mucinous carcinoma... -2.700 3.2e-05
intraductal papillary-mucinous neoplasm ... -2.100 9.7e-03
invasive ductal carcinoma -2.011 1.0e-03
medulloblastoma, large-cell -1.200 2.7e-04
osteosarcoma 1.056 4.4e-05
Pick disease -1.100 4.4e-02
psoriasis -1.300 1.3e-16

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRGAQRAGRRSEQLREDRTIPLIVTGTPSKGFDE      1 - 70
KAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLPATSVIITFHNEARSTLL     71 - 140
RTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKVKCLRNDRREGLIRSRVRGADVAAATVLTFL    141 - 210
DSHCEVNTEWLPPMLQRVKEDHTRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTR    211 - 280
TDPTRPIRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKR    281 - 350
HPYNFPEGNALTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLENVY    351 - 420
PELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLIQQQGKCLAAT    421 - 490
STLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT      491 - 558
//

Text Mined References (8)

PMID Year Title