Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.65
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.400 2.0e-02
osteosarcoma 1.056 4.4e-05
glioblastoma -1.800 4.9e-03
cystic fibrosis -1.415 4.1e-06
atypical teratoid / rhabdoid tumor -1.200 7.5e-03
medulloblastoma, large-cell -2.500 2.6e-05
Atopic dermatitis -1.100 2.6e-02
intraductal papillary-mucinous adenoma (... -2.300 1.4e-04
intraductal papillary-mucinous carcinoma... -2.700 3.2e-05
intraductal papillary-mucinous neoplasm ... -2.100 9.7e-03
pediatric high grade glioma -1.600 8.2e-04
group 3 medulloblastoma -1.600 1.4e-04
psoriasis -1.300 1.3e-16
invasive ductal carcinoma -2.903 1.4e-04
inflammatory breast cancer -2.300 7.4e-03
breast carcinoma -1.500 9.8e-20
Pick disease -1.100 4.4e-02
ductal carcinoma in situ -2.100 4.1e-03

 GO Process (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRGAQRAGRRSEQLREDRTIPLIVTGTPSKGFDE      1 - 70
KAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLPATSVIITFHNEARSTLL     71 - 140
RTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKVKCLRNDRREGLIRSRVRGADVAAATVLTFL    141 - 210
DSHCEVNTEWLPPMLQRVKEDHTRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTR    211 - 280
TDPTRPIRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKR    281 - 350
HPYNFPEGNALTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLENVY    351 - 420
PELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLIQQQGKCLAAT    421 - 490
STLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT      491 - 558
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22186971 2012 UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases: completion of the family tree.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.