Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.01
PubTator Score 5.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
oligodendroglioma 1.200 3.5e-02
osteosarcoma -2.860 1.0e-04
posterior fossa group A ependymoma 2.100 9.3e-05
sonic hedgehog group medulloblastoma -1.800 2.1e-03
cystic fibrosis 1.800 2.8e-03
atypical teratoid/rhabdoid tumor -1.900 2.6e-04
acute quadriplegic myopathy 1.297 1.6e-05
Atopic dermatitis -1.300 8.9e-03
intraductal papillary-mucinous adenoma (... -1.200 3.2e-04
intraductal papillary-mucinous carcinoma... -1.200 5.0e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.5e-03
breast carcinoma -1.400 1.3e-03
fibroadenoma -1.300 4.8e-02
Breast cancer -2.700 2.5e-02
pilocytic astrocytoma 1.400 1.9e-03
psoriasis -1.700 5.3e-06
Pick disease 1.400 3.9e-03
ductal carcinoma in situ -3.100 4.1e-04
invasive ductal carcinoma -3.600 8.9e-04
ovarian cancer -1.300 1.0e-05
pituitary cancer -1.600 4.2e-06

 GO Process (1)

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE      1 - 70
AEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADED     71 - 140
GEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRT    141 - 210
VHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLV    211 - 280
FMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK    281 - 350
ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQ    351 - 420
NQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLA    421 - 490
NVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQH    491 - 560
LCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRF    561 - 630
DQINAVDER                                                                 631 - 639
//

Text Mined References (16)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147861 2004 Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.