Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.85
PubTator Score 15.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 1.3e-04
cystic fibrosis 1.500 9.0e-04
ependymoma -1.300 3.5e-05
esophageal adenocarcinoma -1.500 2.0e-02
group 3 medulloblastoma 2.600 2.1e-04
lung adenocarcinoma 1.600 4.8e-03
lung carcinoma 1.500 3.1e-16
medulloblastoma, large-cell 1.800 3.5e-03
non-small cell lung cancer 1.996 5.9e-13
ovarian cancer -1.100 1.3e-03
pituitary cancer -1.100 2.9e-02

Gene RIF (16)

AA Sequence

MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPKPSDADWDDLWDQFDERRYLNAKKWRVG      1 - 70
DDPYKLYAFNQRESERISSNRAIPDTRHLRCTLLVYCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPT     71 - 140
HLIREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQ    141 - 210
PLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPII    211 - 280
AGGLFVIDKAWFDYLGKYDMDMDIWGGENFEISFRVWMCGGSLEIVPCSRVGHVFRKKHPYVFPDGNANT    281 - 350
YIKNTKRTAEVWMDEYKQYYYAARPFALERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQ    351 - 420
KGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYTQQILQEELCLSVITLFPGAPVVL    421 - 490
VLCKNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVSS            491 - 552
//

Text Mined References (26)

PMID Year Title