Property Summary

NCBI Gene PubMed Count 21
PubMed Score 3.46
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 1.3e-02
oligodendroglioma 2.200 1.6e-02
posterior fossa group A ependymoma -1.900 3.1e-08
atypical teratoid / rhabdoid tumor -1.900 2.7e-03
medulloblastoma, large-cell 1.100 2.0e-03
primitive neuroectodermal tumor -1.700 5.1e-03
lung adenocarcinoma -1.900 2.3e-17
group 3 medulloblastoma -1.700 1.3e-04
pilocytic astrocytoma 1.700 5.3e-03
lung carcinoma 4.400 9.1e-37
non-small cell lung carcinoma -1.100 6.1e-12
facioscapulohumeral dystrophy 1.900 4.9e-02

 MGI Phenotype (1)

Gene RIF (6)

PMID Text
26589799 Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium.
24038392 we integrated different computational tools to perform the in silico analysis of clinically significant mutations (nsSNPs/single amino acid change) at both functional and structural levels, found in human GALNT3, GALNT8, GALNT12, and GALNT13 genes.
22679008 GALNT13 encodes a glycosyltransferase enzyme responsible for the synthesis of O-glycan.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
12407114 cloning and characterization of pp-GalNAc-T13; expressed in all neuroblastoma cells examined and primary cultured neurons but not in glioblastoma cells and primary cultured astrocytes

AA Sequence

MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDD      1 - 70
QEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVIN     71 - 140
RSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAH    141 - 210
CECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGD    211 - 280
RTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATP    281 - 350
YTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD    351 - 420
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGP    421 - 490
VIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT        491 - 556
//

Text Mined References (22)

PMID Year Title
26589799 2016 MicroRNA-424 Predicts a Role for ?-1,4 Branched Glycosylation in Cell Cycle Progression.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24038392 2014 Clinically significant missense variants in human GALNT3, GALNT8, GALNT12, and GALNT13 genes: intriguing in silico findings.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22679008 2012 A novel molecular signature for elevated tricuspid regurgitation velocity in sickle cell disease.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407114 2003 Cloning and characterization of a new human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, designated pp-GalNAc-T13, that is specifically expressed in neurons and synthesizes GalNAc alpha-serine/threonine antigen.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9847074 1998 Toward a complete human genome sequence.