Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.61
PubTator Score 9.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.771 6.1e-04
malignant mesothelioma -4.400 1.6e-09
psoriasis -1.300 1.9e-05
cystic fibrosis 1.785 2.2e-05
atypical teratoid / rhabdoid tumor 2.800 2.6e-05
Atopic dermatitis -1.300 7.0e-04
intraductal papillary-mucinous adenoma (... 2.600 1.6e-04
intraductal papillary-mucinous carcinoma... 2.700 1.5e-04
intraductal papillary-mucinous neoplasm ... 2.400 5.2e-03
Hydrolethalus syndrome -1.479 3.0e-02
colon cancer -1.700 2.3e-02
lung cancer -2.000 8.0e-05
interstitial cystitis -1.600 1.9e-03
group 3 medulloblastoma 2.500 1.4e-02
nasopharyngeal carcinoma -1.500 2.6e-02
lung adenocarcinoma 1.063 7.0e-04
invasive ductal carcinoma -1.400 3.8e-02
ulcerative colitis -1.700 7.9e-07
ovarian cancer -2.100 3.5e-06
pituitary cancer 4.100 5.0e-07

Gene RIF (7)

PMID Text
24115450 Results rule out GALNT12 as a major high familial colorectal cancer susceptibility gene. Additional studies are required to provide further evidence about its role as a moderate/low susceptibility gene in familial aggregation of cancer.
24038392 we integrated different computational tools to perform the in silico analysis of clinically significant mutations (nsSNPs/single amino acid change) at both functional and structural levels, found in human GALNT3, GALNT8, GALNT12, and GALNT13 genes.
22461326 Inherited deleterious variants in GALNT12 are associated with CRC susceptibility.
19617566 inactivating GALNT12 mutations were identified as acquired somatic mutations in a set of 30 microsatellite stable colon tumors.
19617566 Observational study of gene-disease association. (HuGE Navigator)
15557789 The expression of pp-GalNAc-T12 seems to be a negative marker especially of metastatic gastric and colorectal cancer
12135769 cloning and characterization

AA Sequence

MWGRTARRRCPRELRRGREALLVLLALLALAGLGSVLRAQRGAGAGAAEPGPPRTPRPGRREPVMPRPPV      1 - 70
PANALGARGEAVRLQLQGEELRLQEESVRLHQINIYLSDRISLHRRLPERWNPLCKEKKYDYDNLPRTSV     71 - 140
IIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKERLANELSGLPKVRLIRANKREGLVR    141 - 210
ARLLGASAARGDVLTFLDCHCECHEGWLEPLLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFD    211 - 280
WRLVFTWHTVPERERIRMQSPVDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGENLEFSFRIWQCG    281 - 350
GVLETHPCSHVGHVFPKQAPYSRNKALANSVRAAEVWMDEFKELYYHRNPRARLEPFGDVTERKQLRDKL    351 - 420
QCKDFKWFLETVYPELHVPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFFEY    421 - 490
TSQKEIRYNTHQPEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFV    491 - 560
PLLRDCTNSDHQKWFFKERML                                                     561 - 581
//

Text Mined References (11)

PMID Year Title
24115450 2014 GALNT12 is not a major contributor of familial colorectal cancer type X.
24038392 2014 Clinically significant missense variants in human GALNT3, GALNT8, GALNT12, and GALNT13 genes: intriguing in silico findings.
22461326 2012 Inherited deleterious variants in GALNT12 are associated with CRC susceptibility.
19617566 2009 Inactivating germ-line and somatic mutations in polypeptide N-acetylgalactosaminyltransferase 12 in human colon cancers.
15557789 2004 Expression of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-12 in gastric and colonic cancer cell lines and in human colorectal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135769 2002 Molecular cloning and characterization of a novel member of the UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase family, pp-GalNAc-T12.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.