Property Summary

NCBI Gene PubMed Count 40
PubMed Score 15.08
PubTator Score 29.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.666 1.1e-02
Multiple myeloma 1.868 1.5e-03
psoriasis -1.500 2.2e-04
astrocytoma 1.100 5.6e-10
osteosarcoma 1.639 2.7e-03
glioblastoma 1.900 1.1e-03
atypical teratoid/rhabdoid tumor 1.200 2.7e-05
juvenile dermatomyositis 1.013 2.4e-09
Atopic dermatitis -1.100 3.1e-03
intraductal papillary-mucinous adenoma (... 1.500 1.9e-03
intraductal papillary-mucinous carcinoma... 1.800 3.0e-03
X-linked cerebral adrenoleukodystrophy 1.300 4.0e-02
lung cancer 1.200 6.7e-04
diabetes mellitus -1.100 1.0e-02
subependymal giant cell astrocytoma 1.521 4.6e-02
invasive ductal carcinoma 1.097 1.3e-02
ovarian cancer 4.900 4.4e-08
pituitary cancer -1.100 1.8e-03

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (16)

PMID Text
26714046 Expression of GALNT3 was reduced in CAD patients, and down regulation of GALNT3 contributed to endothelial injury by promoting apoptosis and up-regulating the expression of MMP-2 and MMP-14 genes via p38 MAPK activation.
26676748 appears to be responsive to the inhibition of GALNT1 and SHH signaling
25730904 Study demonstrates that down-regulation of GALNT1 is sufficient to suppress malignant phenotype of HCC cells by decreasing EGFR signaling.
23317233 High ppGalNAc T1 expresdsion is associated with bladder cancer.
22183981 The GALNT1 is the glycosyltransferase enzyme family covering a single known glycosidic linkage.
22042768 Utilizing unnatural glycopeptide substrates for GalNAc-T3 we demonstrated that the GalNAc-specific sugar recognition of the lectin domain regulates further glycosylation.
21349845 each ppGalNAc T isoform may be uniquely sensitive to peptide sequence and overall charge, which together dictates the substrate sites that will be glycosylated
20498016 Growth factor stimulation regulates O-glycosylation initiation in a Src-dependent fashion by GalNac-T redistribution from golgi to the endoplasmic reticulum.
20142253 the present analysis fails to replicate an earlier reported association of a GALNT1 variant with risk of ovarian cancer
19524017 Data show that the sequences and O-glycosylation patterns direct the addition of the first and second sugar residues by ppGalNAc-T and C1GalT which act in a site directed fashion.
19487295 A direct link between miR-129 and the two putative targets GALNT1 and SOX4 in bladder cancer.
19460755 GalNAc T10 has a large and pronounced glycopeptide preference for Ser/Thr-O-GalNAc only at the +1 position from the acceptor site, whereas T1 and T2 have significantly reduced and variable preferences for Ser/Thr-O-GalNAc.
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18268124 Observational study of gene-disease association. (HuGE Navigator)
17916404 The results indicated that IL-4-treated LS174T cells are able to produce mucins with a higher degree of O-glycosylation than untreated counterparts.
14636048 First simultaneous kinetic description of O-glycosylation events by recombinant UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase I at all putative O-glycosylation sites within human mucin MUC1 containing 5 tandem repeats.

AA Sequence

MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKE      1 - 70
DQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVI     71 - 140
NRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDA    141 - 210
HCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKG    211 - 280
DRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKAT    281 - 350
PYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYP    351 - 420
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNG    421 - 490
PVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF     491 - 559
//

Text Mined References (41)

PMID Year Title
26714046 2016 Down regulation of GALNT3 contributes to endothelial cell injury via activation of p38 MAPK signaling pathway.
26676748 2016 GALNT1-Mediated Glycosylation and Activation of Sonic Hedgehog Signaling Maintains the Self-Renewal and Tumor-Initiating Capacity of Bladder Cancer Stem Cells.
25730904 2015 Knockdown of GALNT1 suppresses malignant phenotype of hepatocellular carcinoma by suppressing EGFR signaling.
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
23317233 2012 ppGalNAc T1 as a potential novel marker for human bladder cancer.
22183981 2012 Control of mucin-type O-glycosylation: a classification of the polypeptide GalNAc-transferase gene family.
22042768 2012 Elucidation of the sugar recognition ability of the lectin domain of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3 by using unnatural glycopeptide substrates.
21349845 2011 Emerging paradigms for the initiation of mucin-type protein O-glycosylation by the polypeptide GalNAc transferase family of glycosyltransferases.
21269460 2011 Initial characterization of the human central proteome.
20498016 2010 Regulation of O-glycosylation through Golgi-to-ER relocation of initiation enzymes.
20142253 2010 Polymorphism in the GALNT1 gene and epithelial ovarian cancer in non-Hispanic white women: the Ovarian Cancer Association Consortium.
19946888 2010 Defining the membrane proteome of NK cells.
19524017 2009 Site directed processing: role of amino acid sequences and glycosylation of acceptor glycopeptides in the assembly of extended mucin type O-glycan core 2.
19487295 2009 Genomic profiling of microRNAs in bladder cancer: miR-129 is associated with poor outcome and promotes cell death in vitro.
19460755 2009 Glycopeptide-preferring polypeptide GalNAc transferase 10 (ppGalNAc T10), involved in mucin-type O-glycosylation, has a unique GalNAc-O-Ser/Thr-binding site in its catalytic domain not found in ppGalNAc T1 or T2.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18268124 2008 Association of single nucleotide polymorphisms in glycosylation genes with risk of epithelial ovarian cancer.
17916404 2008 Interleukin-4 induces specific pp-GalNAc-T expression and alterations in mucin O-glycosylation in colonic epithelial cells.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14636048 2003 Nuclear magnetic resonance-based dissection of a glycosyltransferase specificity for the mucin MUC1 tandem repeat.
12925576 2003 Conformational studies on the MUC1 tandem repeat glycopeptides: implication for the enzymatic O-glycosylation of the mucin protein core.
12506059 2003 The cell-layer- and cell-type-specific distribution of GalNAc-transferases in the ocular surface epithelia is altered during keratinization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364335 2002 The lectin domain of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1 is involved in O-glycosylation of a polypeptide with multiple acceptor sites.
12199709 2002 Identification of two cysteine residues involved in the binding of UDP-GalNAc to UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1).
9847074 1998 Toward a complete human genome sequence.
9592121 1998 Genomic organization and chromosomal localization of three members of the UDP-N-acetylgalactosamine: polypeptide N-acetylgalactosaminyltransferase family.
9394011 1998 Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus.
9312074 1997 Localization of O-glycosylation sites on glycopeptide fragments from lactation-associated MUC1. All putative sites within the tandem repeat are glycosylation targets in vivo.
9295285 1997 Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3.
9050910 1997 A human UDP-GalNAc: polypeptide, N-acetylgalactosaminyltransferase type 1 gene is located at the chromosomal region 18q12.1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8727794 1996 Organization of a human UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase gene and a related processed pseudogene.
8690719 1995 cDNA cloning, expression, and chromosomal localization of a human UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase.
8663203 1996 cDNA cloning and expression of a novel human UDP-N-acetyl-alpha-D-galactosamine. Polypeptide N-acetylgalactosaminyltransferase, GalNAc-t3.
7592619 1995 Purification and cDNA cloning of a human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase.
2681181 1989 Glycosyltransferases. Structure, localization, and control of cell type-specific glycosylation.