Property Summary

NCBI Gene PubMed Count 14
PubMed Score 69.95
PubTator Score 25.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q96C23 Q53RY1 Q8NIA2 V9HWA8
Symbols GLAT
IBD1
BLOCK25
HEL-S-63p

Gene

PANTHER Protein Class (2)

PDB

1SNZ   1SO0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
21339755 This study demonistrated that polymorphism in galactose mutarotase (GALM) is associated with serotonin transporter binding potential in the human thalamus.
15026423 The enzyme is a monomer and has a similar structure to the Lactococcus lactis mutarotase.
12753898 Identification and characterisation of human aldose 1-epimerase.
12753898 Gene encodes a functional aldose 1-epimerase (mutarotase). The enzyme exhibits (approx. four-fold) preference for galactose over glucose. Mutation E307A results in no detactable activity.

AA Sequence

MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP      1 - 70
YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY     71 - 140
PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP    141 - 210
TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF    211 - 280
YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA            281 - 342
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21339755 2011 A non-synonymous polymorphism in galactose mutarotase (GALM) is associated with serotonin transporter binding potential in the human thalamus: results of a genome-wide association study.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18052213 2007 Galactomutarotase and other galactose-related genes are rapidly induced by retinoic acid in human myeloid cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15026423 2004 Molecular structure of human galactose mutarotase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923184 2003 Structure and function of enzymes of the Leloir pathway for galactose metabolism.
12753898 2003 Identification and characterisation of human aldose 1-epimerase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
5661008 1968 Isolation and properties of mutarotase in erythrocytes.
4963341 1967 Mutarotase in erythrocytes: isolation and properties.
1192801 1975 Synteny of the human genes for Gal-1-PT, ACP1, MDH-1, and Gal+-Act and assignment to chromosome 2.
164654 1975 Mutant hamster cells exhibiting a pleiotropic effect on carbohydrate metabolism.