Property Summary

NCBI Gene PubMed Count 14
PubMed Score 71.60
PubTator Score 25.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.078 6.9e-04
diabetes mellitus -1.100 5.4e-03
ependymoma 1.100 2.6e-06
glioblastoma 1.200 4.9e-04
lung carcinoma -2.400 1.6e-29
pancreatic ductal adenocarcinoma liver m... -1.538 3.0e-03
pediatric high grade glioma 1.100 6.1e-04
subependymal giant cell astrocytoma 1.155 3.7e-03
tuberculosis and treatment for 6 months -1.200 3.0e-03

Gene RIF (4)

AA Sequence

MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP      1 - 70
YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY     71 - 140
PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP    141 - 210
TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF    211 - 280
YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA            281 - 342
//

Text Mined References (20)

PMID Year Title