Property Summary

Ligand Count 3
NCBI Gene PubMed Count 37
PubMed Score 265.00
PubTator Score 110.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Galactosemias 3 0.0 0.0
Disease Target Count Z-score Confidence
Galactosemia 19 5.548 2.8
Disease Target Count
Galactose epimerase deficiency 1

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.200 3.3e-09
breast carcinoma 1.100 8.1e-28
ductal carcinoma in situ 1.100 1.8e-02
interstitial cystitis -1.100 1.3e-04
intraductal papillary-mucinous adenoma (... 1.200 4.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.3e-04
intraductal papillary-mucinous neoplasm ... 2.800 4.8e-03
invasive ductal carcinoma 1.800 2.3e-04
osteosarcoma 2.265 1.8e-08
ovarian cancer -1.100 2.5e-04
pancreatic cancer 1.400 5.9e-07
psoriasis 1.100 1.7e-03

Gene RIF (12)

AA Sequence

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ      1 - 70
GALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQ     71 - 140
YLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMP    141 - 210
YVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM    211 - 280
VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA      281 - 348
//

Text Mined References (43)

PMID Year Title