Property Summary

NCBI Gene PubMed Count 48
PubMed Score 60.68
PubTator Score 46.51

Knowledge Summary

Patent (4,409)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 1.3e-03
intraductal papillary-mucinous carcinoma... 1.100 8.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.1e-03
ovarian cancer 1.400 9.0e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
25975492 This meta-analysis suggests that GAK rs1564282 C/T polymorphism is associated with increased susceptibility to Parkinson's disease--{REVIEW}
25914293 Data indicated that GBA and TMEM175/GAK significantly alter age at onset in PD.
25653444 AAK1 and GAK are critical regulators of HCV entry that function in part by activating EGFR, AP2M1, and NUMB, and as the molecular targets underlying the antiviral effect of sunitinib and erlotinib, respectively.
24510904 Cyclin-G-associated kinase is a binding partners of LRRK2, a candidate genes for risk for sporadic Parkinson disease, and part of a complex that promotes clearance of Golgi-derived vesicles through the autophagy-lysosome system.
24438162 GAK apo structure reveals a dimeric inactive state of the catalytic domain mediated by an unusual activation segment interaction.
24039160 The effects of rs11248051 and rs1564282 variants of GAK, and the rs3129882 variant of HLA-DRA, were investigated in Parkinson's disease patients.
23826309 neither the CT, TT genotypes nor the minor allele T of single nucleotide polymorphism rs1564282 were associated with Parkinson's disease among the subjects from Taiwan and Singapore.
23618683 rs11248060 significantly increasThis study found that the minor alleles of GAK rpopulationss1564282 and DGKQ e the risk of PD in Han Chinese .
23591012 Dominant negative mutants of IRAK4 and GAK show strong apoptotic effects in A498 cells under anoxia.
22262175 GAK as a regulator of dephosphorylation events under the control of the PP2A B'gamma subunit.
22198721 study demonstrated that the rs1564282 variant in GAK (PARK17) increases the risk of Parkinson's disease in Han Chinese patients from mainland China
22190034 HIV-1 PR is identified to have a physical interaction with cyclin G associated kinase (GAK) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21258085 cyclin G associated kinase is associated with Parkinson disease risk and suggest that cyclin G associated kinase and alpha-synuclein interact in a pathway involved in disease pathogenesis
21058943 GAK is a new candidate for investigation in future studies.
21058943 Observational study of gene-disease association. (HuGE Navigator)
21044948 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20881269 Osteosarcoma cell proliferation and survival are dependent on GAK.
20711177 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237935 results identify a role for GAK and clathrin in microtubule outgrowth from kinetochores/chromosomes and suggest that GAK acts through clathrin to control microtubule outgrowth around chromosomes
19654208 GAK and CHC cooperated in the same pathway and interacted in mitosis to regulate the formation of a functional spindle.
19371378 The GAK localizes in both cytoplasm and nucleus by immunostaining, ectopic expression of GFP-GAK and pull-down assays using dissected GAK fragments.
17538018 Interactions between the PsiG[PDE][PsiLM]-motif sequences in GAK and the AP1-gamma-ear domain are critical for the recruitment of GAK to the trans-Golgi network and the function of GAK in lysosomal enzyme sorting.
16895969 Results describe the recruitment dynamics of GAK and auxilin to clathrin-coated pits during endocytosis.
16161052 GAK enhanced the androgen receptor transcriptional response even at low concentrations of androgens
15240878 down-regulation of GAK results in outgrowth of cells in soft agar, raising the possibility that loss of GAK function may promote tumorigenesis.

AA Sequence

MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKR      1 - 70
LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESR     71 - 140
GPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQR    141 - 210
RALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPP    211 - 280
HDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPP    281 - 350
VGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM    351 - 420
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAPHLHTLYNICR    421 - 490
NMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC    491 - 560
DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVI    561 - 630
PLGVTVQGDVLIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDL    631 - 700
FQVNLEVEVEPRDRPSREAPPWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGS    701 - 770
PEAEPTDSDSPPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG    771 - 840
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQACKAPSSNTDL    841 - 910
LSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDL    911 - 980
FGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAP    981 - 1050
TPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ   1051 - 1120
TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFS   1121 - 1190
SRSDKKGPKTIAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP   1191 - 1260
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF                      1261 - 1311
//

Text Mined References (58)

PMID Year Title
26345367 2015 The clathrin-binding and J-domains of GAK support the uncoating and chaperoning of clathrin by Hsc70 in the brain.
25975492 2015 Quantitative assessment of the association between GAK rs1564282 C/T polymorphism and the risk of Parkinson's disease.
25914293 2015 Impact of Parkinson's disease risk loci on age at onset.
25653444 2015 AP-2-associated protein kinase 1 and cyclin G-associated kinase regulate hepatitis C virus entry and are potential drug targets.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24438162 2014 Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24039160 2013 Reaffirmation of GAK, but not HLA-DRA, as a Parkinson's disease susceptibility gene in a Taiwanese population.
23826309 2013 Genetic variations of GAK in two Chinese Parkinson's disease populations: a case-control study.
23618683 2013 GAK rs1564282 and DGKQ rs11248060 increase the risk for Parkinson's disease in a Chinese population.
23591012 2013 A kinome-wide siRNA screen identifies multiple roles for protein kinases in hypoxic stress adaptation, including roles for IRAK4 and GAK in protection against apoptosis in VHL-/- renal carcinoma cells, despite activation of the NF-?B pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
22438815 2012 Comprehensive research synopsis and systematic meta-analyses in Parkinson's disease genetics: The PDGene database.
22262175 2012 Cyclin G-associated kinase regulates protein phosphatase 2A by phosphorylation of its B'? subunit.
22198721 2012 GWAS-linked GAK locus in Parkinson's disease in Han Chinese and meta-analysis.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21269460 2011 Initial characterization of the human central proteome.
21258085 2011 Cyclin-G-associated kinase modifies ?-synuclein expression levels and toxicity in Parkinson's disease: results from the GenePD Study.
21058943 2011 Replication of GWAS associations for GAK and MAPT in Parkinson's disease.
21044948 2011 Dissection of the genetics of Parkinson's disease identifies an additional association 5' of SNCA and multiple associated haplotypes at 17q21.
20881269 2010 Cyclin G-associated kinase is necessary for osteosarcoma cell proliferation and receptor trafficking.
20711177 2010 Common genetic variation in the HLA region is associated with late-onset sporadic Parkinson's disease.
20237935 2010 Cyclin G-associated kinase promotes microtubule outgrowth from chromosomes during spindle assembly.
20160091 2010 Endocytosis and clathrin-uncoating defects at synapses of auxilin knockout mice.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19654208 2009 GAK, a regulator of clathrin-mediated membrane traffic, also controls centrosome integrity and chromosome congression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19371378 2009 GAK, a regulator of clathrin-mediated membrane trafficking, localizes not only in the cytoplasm but also in the nucleus.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18985386 2009 Genomewide association study for susceptibility genes contributing to familial Parkinson disease.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17538018 2007 Canonical interaction of cyclin G associated kinase with adaptor protein 1 regulates lysosomal enzyme sorting.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16895969 2006 Recruitment dynamics of GAK and auxilin to clathrin-coated pits during endocytosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16161052 2006 Cyclin G-associated kinase: a novel androgen receptor-interacting transcriptional coactivator that is overexpressed in hormone refractory prostate cancer.
16155256 2005 Depletion of GAK/auxilin 2 inhibits receptor-mediated endocytosis and recruitment of both clathrin and clathrin adaptors.
15752756 2005 Identification of novel CBP interacting proteins in embryonic orofacial tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240878 2004 The serine/threonine kinase cyclin G-associated kinase regulates epidermal growth factor receptor signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732633 2003 Molecular and functional characterization of clathrin- and AP-2-binding determinants within a disordered domain of auxilin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12010461 2002 CK2 and GAK/auxilin2 are major protein kinases in clathrin-coated vesicles.
11148137 2001 Expression of auxilin or AP180 inhibits endocytosis by mislocalizing clathrin: evidence for formation of nascent pits containing AP1 or AP2 but not clathrin.
10887964 2000 Identification of the universal cofactor (auxilin 2) in clathrin coat dissociation.
10625686 2000 Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.
9299234 1997 Structure, expression, and chromosomal localization of human GAK.
9013862 1997 GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain.