Property Summary

NCBI Gene PubMed Count 6
PubMed Score 32.36
PubTator Score 12.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Liver neoplasms 108
Disease Target Count P-value
ovarian cancer 8491 5.0e-18
osteosarcoma 7933 2.4e-04
Disease Target Count Z-score Confidence
Bipolar Disorder 266 4.383 2.2
Stiff-Person syndrome 11 3.856 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.631 2.4e-04
ovarian cancer -4.300 5.0e-18

Synonym

Accession Q6ZQY3
Symbols ADC
CSADC
HuADC
HuCSADC

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26327310 taurine biosynthesis in vertebrates involves two structurally related PLP-dependent decarboxylases (cysteine sulfinic acid decarboxylase and glutamic acid decarboxylase like 1)
25415457 The study did not identify a major relationship between the GADL1 polymorphisms and lithium response in an Indian population.
24369049 Genetic variations in GADL1 are associated with the response to lithium maintenance treatment for bipolar I disorder in patients of Han Chinese descent.

AA Sequence

MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEVVLKATDVNEK      1 - 70
VCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQLYAGLDYYSLVARFMTEALN     71 - 140
PSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGGSVSNMYAMNLARYKYCPDIKEKGLSGSPRL    141 - 210
ILFTSAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGA    211 - 280
FDPLDEIADICERHSLWLHVDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKS    281 - 350
DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV    351 - 420
DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKV    421 - 490
NFFRQVVISPQVSREDMDFLLDEIDLLGKDM                                           491 - 521
//

Text Mined References (11)

PMID Year Title
26327310 2015 Mammalian CSAD and GADL1 have distinct biochemical properties and patterns of brain expression.
25415457 2015 GADL1 gene polymorphisms and lithium response in bipolar I disorder: lack of association from an Indian population.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24369049 2014 Variant GADL1 and response to lithium therapy in bipolar I disorder.
23568457 2013 Genetic variants associated with disordered eating.
23038267 2012 Role of glutamate decarboxylase-like protein 1 (GADL1) in taurine biosynthesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.